Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WXY5

Protein Details
Accession A0A0C9WXY5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-35TARRHGPTTTRHYQRKRRAPIRHRPTNVTHydrophilic
NLS Segment(s)
PositionSequence
22-26KRRAP
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTTTIITARRHGPTTTRHYQRKRRAPIRHRPTNVTPPPSTADWRLTTGTPHVNTHVNAHQMEGDTGHWGPHRIDDDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.55
4 0.6
5 0.68
6 0.77
7 0.82
8 0.85
9 0.87
10 0.87
11 0.88
12 0.89
13 0.9
14 0.9
15 0.89
16 0.82
17 0.78
18 0.75
19 0.74
20 0.7
21 0.64
22 0.54
23 0.46
24 0.45
25 0.39
26 0.35
27 0.26
28 0.24
29 0.2
30 0.22
31 0.21
32 0.18
33 0.18
34 0.19
35 0.22
36 0.2
37 0.2
38 0.2
39 0.22
40 0.22
41 0.25
42 0.26
43 0.24
44 0.23
45 0.22
46 0.22
47 0.2
48 0.19
49 0.16
50 0.13
51 0.12
52 0.12
53 0.14
54 0.13
55 0.15
56 0.15
57 0.2
58 0.23