Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WYY1

Protein Details
Accession A0A0C9WYY1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
67-88IPVDKRGHRRELRRQSHTHTNPBasic
NLS Segment(s)
PositionSequence
63-77KKRLIPVDKRGHRRE
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSMCAPYESSPHSLAPINVRDKWFWNIDCIDAAAPALAYGCRVFGMSLSQVHIRLRSPPTSEKKRLIPVDKRGHRRELRRQSHTHTNPIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.3
4 0.31
5 0.33
6 0.35
7 0.34
8 0.35
9 0.38
10 0.37
11 0.3
12 0.29
13 0.26
14 0.25
15 0.24
16 0.21
17 0.17
18 0.12
19 0.11
20 0.07
21 0.05
22 0.04
23 0.04
24 0.03
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.06
33 0.06
34 0.07
35 0.09
36 0.09
37 0.11
38 0.11
39 0.12
40 0.11
41 0.16
42 0.19
43 0.2
44 0.24
45 0.31
46 0.4
47 0.48
48 0.54
49 0.54
50 0.56
51 0.62
52 0.65
53 0.66
54 0.65
55 0.66
56 0.71
57 0.75
58 0.78
59 0.75
60 0.77
61 0.76
62 0.77
63 0.78
64 0.79
65 0.8
66 0.79
67 0.8
68 0.78
69 0.81
70 0.77