Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WRN5

Protein Details
Accession A0A0C9WRN5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-112NPVPRINHPCRRNRPTKIRNRWNPAPRPIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences LLTTHPPGQSQGAPPTSHHVGCVNLTTHTSLQTRRESAHPVPHQTRPPPLHQSPLTKIPTKPPENPQNHPSTHGNNPSTHGNNPVPRINHPCRRNRPTKIRNRWNPAPRPIDEDPAPLSKPTPTLQPGAYPPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.38
4 0.34
5 0.31
6 0.25
7 0.23
8 0.23
9 0.26
10 0.2
11 0.16
12 0.17
13 0.19
14 0.17
15 0.19
16 0.21
17 0.21
18 0.25
19 0.3
20 0.31
21 0.3
22 0.33
23 0.35
24 0.37
25 0.43
26 0.42
27 0.44
28 0.47
29 0.5
30 0.53
31 0.49
32 0.54
33 0.47
34 0.49
35 0.49
36 0.47
37 0.48
38 0.46
39 0.48
40 0.44
41 0.48
42 0.46
43 0.41
44 0.4
45 0.42
46 0.47
47 0.46
48 0.47
49 0.47
50 0.53
51 0.55
52 0.59
53 0.55
54 0.51
55 0.47
56 0.46
57 0.41
58 0.35
59 0.36
60 0.38
61 0.36
62 0.31
63 0.33
64 0.33
65 0.33
66 0.3
67 0.3
68 0.27
69 0.28
70 0.31
71 0.33
72 0.3
73 0.31
74 0.4
75 0.42
76 0.47
77 0.51
78 0.58
79 0.64
80 0.71
81 0.77
82 0.78
83 0.81
84 0.83
85 0.87
86 0.88
87 0.89
88 0.9
89 0.9
90 0.9
91 0.89
92 0.87
93 0.85
94 0.8
95 0.7
96 0.68
97 0.61
98 0.58
99 0.49
100 0.43
101 0.38
102 0.35
103 0.34
104 0.27
105 0.26
106 0.21
107 0.23
108 0.21
109 0.25
110 0.24
111 0.27
112 0.28
113 0.32
114 0.34