Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YFJ8

Protein Details
Accession A0A0C9YFJ8    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-45STSVSLLKAKKKAKKPKLVSAHEDPHydrophilic
NLS Segment(s)
PositionSequence
28-37KAKKKAKKPK
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSEIDDIFTSKDKSKTVPSPSTSVSLLKAKKKAKKPKLVSAHEDPAHASSSAITPASKKRPPPETVVDTSANLPSLKRQKKETGPGKVRVRQTTKSDLSEPNGGLFKDSRGSGARRTTDEGLSIYKEDELGIRDDGGDTPLCPFDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.47
4 0.52
5 0.51
6 0.52
7 0.53
8 0.52
9 0.45
10 0.38
11 0.33
12 0.32
13 0.35
14 0.37
15 0.43
16 0.48
17 0.55
18 0.64
19 0.72
20 0.75
21 0.8
22 0.81
23 0.83
24 0.86
25 0.83
26 0.8
27 0.76
28 0.74
29 0.64
30 0.56
31 0.47
32 0.38
33 0.32
34 0.25
35 0.18
36 0.1
37 0.1
38 0.1
39 0.1
40 0.08
41 0.09
42 0.15
43 0.23
44 0.26
45 0.29
46 0.35
47 0.41
48 0.44
49 0.48
50 0.49
51 0.47
52 0.46
53 0.46
54 0.4
55 0.34
56 0.32
57 0.26
58 0.2
59 0.14
60 0.11
61 0.13
62 0.22
63 0.27
64 0.28
65 0.32
66 0.38
67 0.44
68 0.54
69 0.57
70 0.58
71 0.59
72 0.66
73 0.68
74 0.67
75 0.67
76 0.64
77 0.61
78 0.56
79 0.55
80 0.55
81 0.51
82 0.48
83 0.47
84 0.42
85 0.4
86 0.38
87 0.33
88 0.27
89 0.25
90 0.22
91 0.2
92 0.17
93 0.15
94 0.14
95 0.14
96 0.14
97 0.16
98 0.18
99 0.22
100 0.29
101 0.31
102 0.31
103 0.36
104 0.37
105 0.34
106 0.33
107 0.29
108 0.24
109 0.23
110 0.21
111 0.16
112 0.14
113 0.13
114 0.12
115 0.12
116 0.11
117 0.12
118 0.12
119 0.12
120 0.12
121 0.12
122 0.13
123 0.13
124 0.12
125 0.1
126 0.11
127 0.15
128 0.15
129 0.15
130 0.16