Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XBV9

Protein Details
Accession A0A0C9XBV9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPPLPRKRTRKRKRRAAVSSSESSSHydrophilic
NLS Segment(s)
PositionSequence
5-16PRKRTRKRKRRA
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MPPLPRKRTRKRKRRAAVSSSESSSSSESDSSSSNESAHPTTSLPKQSNSDSDSDSDSDSSDSSSSSDASLSAKTKTQPNAAEAAMPKTLRHLSPSPSPPPADLPSFLPSQGAPGNSNGEKEQAMKDRFRQFWMASVSDAFKEDLEDIRKEHDFGATRLGLLIDALAGGAEVFEPGGEMEVVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.91
4 0.9
5 0.86
6 0.81
7 0.72
8 0.62
9 0.52
10 0.43
11 0.35
12 0.26
13 0.2
14 0.16
15 0.13
16 0.13
17 0.14
18 0.14
19 0.16
20 0.16
21 0.15
22 0.16
23 0.18
24 0.18
25 0.18
26 0.17
27 0.14
28 0.18
29 0.23
30 0.29
31 0.28
32 0.29
33 0.32
34 0.33
35 0.37
36 0.35
37 0.33
38 0.27
39 0.26
40 0.25
41 0.23
42 0.21
43 0.16
44 0.14
45 0.12
46 0.11
47 0.1
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.09
58 0.1
59 0.1
60 0.12
61 0.14
62 0.19
63 0.21
64 0.25
65 0.24
66 0.25
67 0.26
68 0.24
69 0.25
70 0.21
71 0.2
72 0.17
73 0.15
74 0.13
75 0.13
76 0.15
77 0.13
78 0.16
79 0.16
80 0.18
81 0.25
82 0.3
83 0.3
84 0.31
85 0.31
86 0.27
87 0.29
88 0.28
89 0.22
90 0.19
91 0.18
92 0.18
93 0.18
94 0.18
95 0.14
96 0.12
97 0.13
98 0.13
99 0.12
100 0.11
101 0.11
102 0.16
103 0.16
104 0.17
105 0.15
106 0.15
107 0.14
108 0.15
109 0.18
110 0.22
111 0.25
112 0.26
113 0.33
114 0.4
115 0.41
116 0.42
117 0.42
118 0.34
119 0.37
120 0.39
121 0.33
122 0.25
123 0.25
124 0.24
125 0.2
126 0.21
127 0.15
128 0.11
129 0.11
130 0.11
131 0.14
132 0.17
133 0.18
134 0.17
135 0.21
136 0.22
137 0.22
138 0.21
139 0.23
140 0.22
141 0.21
142 0.27
143 0.23
144 0.22
145 0.22
146 0.21
147 0.15
148 0.12
149 0.11
150 0.04
151 0.04
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.05
164 0.05