Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WUF8

Protein Details
Accession A0A0C9WUF8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-33GLQSKAKKVKPPVQPTRKKPGCPHydrophilic
NLS Segment(s)
PositionSequence
17-28KKVKPPVQPTRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDVDDQNIDPGLQSKAKKVKPPVQPTRKKPGCPSKTDQKARTDPIPDDQDNIATSQFLQPVTPPRKAGKKDIHQNPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.33
3 0.38
4 0.45
5 0.52
6 0.57
7 0.63
8 0.72
9 0.76
10 0.77
11 0.83
12 0.82
13 0.85
14 0.82
15 0.76
16 0.75
17 0.75
18 0.7
19 0.67
20 0.67
21 0.66
22 0.7
23 0.74
24 0.69
25 0.65
26 0.63
27 0.59
28 0.57
29 0.49
30 0.4
31 0.38
32 0.4
33 0.33
34 0.31
35 0.27
36 0.25
37 0.22
38 0.22
39 0.16
40 0.09
41 0.1
42 0.1
43 0.11
44 0.1
45 0.1
46 0.11
47 0.22
48 0.27
49 0.3
50 0.31
51 0.36
52 0.45
53 0.5
54 0.57
55 0.58
56 0.64
57 0.71