Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X532

Protein Details
Accession A0A0C9X532    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-35DIERQRRRAENLRRRARRFRVLIBasic
NLS Segment(s)
PositionSequence
18-31RRRAENLRRRARRF
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
Amino Acid Sequences MSPSNTEFQGAEDIERQRRRAENLRRRARRFRVLIIGRANAGKTTILQRVCNTTEQPKIFNQSGHEIDLSELNPTAQRGEHDIENEMIFESNTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.35
4 0.36
5 0.39
6 0.45
7 0.5
8 0.57
9 0.59
10 0.66
11 0.76
12 0.8
13 0.83
14 0.86
15 0.84
16 0.82
17 0.76
18 0.7
19 0.69
20 0.62
21 0.61
22 0.54
23 0.47
24 0.38
25 0.34
26 0.29
27 0.19
28 0.16
29 0.11
30 0.08
31 0.1
32 0.14
33 0.15
34 0.16
35 0.17
36 0.2
37 0.22
38 0.23
39 0.21
40 0.21
41 0.26
42 0.26
43 0.28
44 0.26
45 0.29
46 0.29
47 0.28
48 0.26
49 0.26
50 0.26
51 0.25
52 0.24
53 0.19
54 0.18
55 0.19
56 0.16
57 0.11
58 0.1
59 0.09
60 0.1
61 0.1
62 0.11
63 0.09
64 0.11
65 0.14
66 0.18
67 0.2
68 0.2
69 0.22
70 0.22
71 0.22
72 0.21
73 0.17
74 0.14