Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WNS6

Protein Details
Accession Q4WNS6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-55NNKVLPPQPRSPPKKSSRPQSSNRVNKAKSRSRKDVNDLKISHydrophilic
NLS Segment(s)
PositionSequence
23-46RSPPKKSSRPQSSNRVNKAKSRSR
Subcellular Location(s) mito 20, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0032993  C:protein-DNA complex  
GO:0032131  F:alkylated DNA binding  
GO:0008725  F:DNA-3-methyladenine glycosylase activity  
GO:0043916  F:DNA-7-methylguanine glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
GO:0006307  P:DNA dealkylation involved in DNA repair  
KEGG afm:AFUA_4G06800  -  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MALRRSARLNTALNNKVLPPQPRSPPKKSSRPQSSNRVNKAKSRSRKDVNDLKISVEQLPLDVTLPDSGAIPVSNNNVETVNTLDLISTDPPSRLHATPPPLDRPVEPHRTNATLLTPHGSSLVAYPPGSESLSPSKTGRPRPTATTGTLLEKAVAHLIATDARLEPLIRRHPCPLFSPEGLAEEIDPFRSLVSSIIGQQVSGAAARSIKDKFVALFNKDNEGQDPAKPPRFPTPEEVVQCDLATLRTAGLSQRKAEYIHGLSQKFATGELSARMLLNASDEELVEKLTAVRGLGRWSVEMFACFALKRIDVFSTGDLGVQRGCAAFMGKDVSKLKAKGGGKFKYMAEKDMLELAAKFAPYRSLFMWYMWRVEDVDVTVMNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.43
4 0.45
5 0.44
6 0.41
7 0.44
8 0.53
9 0.62
10 0.69
11 0.7
12 0.75
13 0.78
14 0.82
15 0.83
16 0.84
17 0.85
18 0.86
19 0.86
20 0.87
21 0.88
22 0.87
23 0.88
24 0.87
25 0.8
26 0.78
27 0.8
28 0.8
29 0.79
30 0.78
31 0.79
32 0.78
33 0.83
34 0.84
35 0.84
36 0.81
37 0.79
38 0.7
39 0.64
40 0.58
41 0.51
42 0.43
43 0.35
44 0.27
45 0.18
46 0.18
47 0.15
48 0.12
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.09
60 0.12
61 0.13
62 0.13
63 0.14
64 0.14
65 0.14
66 0.14
67 0.15
68 0.12
69 0.11
70 0.11
71 0.1
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.16
80 0.2
81 0.19
82 0.23
83 0.27
84 0.32
85 0.37
86 0.4
87 0.42
88 0.4
89 0.41
90 0.37
91 0.38
92 0.4
93 0.44
94 0.41
95 0.4
96 0.41
97 0.42
98 0.42
99 0.37
100 0.31
101 0.24
102 0.23
103 0.21
104 0.17
105 0.15
106 0.15
107 0.13
108 0.1
109 0.1
110 0.12
111 0.11
112 0.1
113 0.11
114 0.11
115 0.12
116 0.12
117 0.11
118 0.11
119 0.16
120 0.18
121 0.19
122 0.2
123 0.25
124 0.31
125 0.4
126 0.44
127 0.44
128 0.46
129 0.5
130 0.55
131 0.52
132 0.47
133 0.43
134 0.37
135 0.33
136 0.32
137 0.26
138 0.2
139 0.17
140 0.15
141 0.11
142 0.1
143 0.06
144 0.05
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.13
155 0.21
156 0.23
157 0.25
158 0.3
159 0.32
160 0.33
161 0.36
162 0.34
163 0.3
164 0.28
165 0.27
166 0.23
167 0.22
168 0.2
169 0.17
170 0.12
171 0.09
172 0.09
173 0.07
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.05
181 0.06
182 0.07
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.08
189 0.07
190 0.07
191 0.04
192 0.05
193 0.05
194 0.08
195 0.08
196 0.09
197 0.09
198 0.1
199 0.1
200 0.16
201 0.19
202 0.21
203 0.26
204 0.26
205 0.29
206 0.3
207 0.29
208 0.24
209 0.24
210 0.21
211 0.18
212 0.24
213 0.26
214 0.3
215 0.3
216 0.31
217 0.37
218 0.4
219 0.4
220 0.39
221 0.41
222 0.43
223 0.44
224 0.45
225 0.37
226 0.33
227 0.3
228 0.24
229 0.18
230 0.11
231 0.1
232 0.07
233 0.06
234 0.05
235 0.06
236 0.09
237 0.15
238 0.17
239 0.18
240 0.2
241 0.21
242 0.22
243 0.23
244 0.25
245 0.22
246 0.26
247 0.31
248 0.29
249 0.28
250 0.28
251 0.28
252 0.22
253 0.2
254 0.14
255 0.09
256 0.1
257 0.1
258 0.11
259 0.1
260 0.1
261 0.1
262 0.09
263 0.08
264 0.08
265 0.07
266 0.07
267 0.07
268 0.07
269 0.08
270 0.08
271 0.08
272 0.07
273 0.07
274 0.06
275 0.07
276 0.07
277 0.07
278 0.08
279 0.09
280 0.12
281 0.14
282 0.14
283 0.14
284 0.14
285 0.16
286 0.15
287 0.14
288 0.13
289 0.11
290 0.12
291 0.11
292 0.12
293 0.12
294 0.12
295 0.12
296 0.13
297 0.14
298 0.15
299 0.17
300 0.16
301 0.17
302 0.16
303 0.17
304 0.15
305 0.15
306 0.13
307 0.11
308 0.11
309 0.08
310 0.08
311 0.07
312 0.08
313 0.08
314 0.09
315 0.14
316 0.14
317 0.2
318 0.21
319 0.25
320 0.3
321 0.31
322 0.32
323 0.35
324 0.38
325 0.41
326 0.48
327 0.49
328 0.46
329 0.49
330 0.49
331 0.51
332 0.49
333 0.45
334 0.39
335 0.34
336 0.32
337 0.32
338 0.3
339 0.21
340 0.19
341 0.18
342 0.17
343 0.16
344 0.15
345 0.12
346 0.18
347 0.19
348 0.22
349 0.21
350 0.26
351 0.26
352 0.28
353 0.37
354 0.32
355 0.33
356 0.31
357 0.31
358 0.26
359 0.26
360 0.26
361 0.18
362 0.18