Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YDA1

Protein Details
Accession A0A0C9YDA1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
23-50YCGRLCQKADWKKHRKWCKKDLDLTTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MMKPEGSLLRCAGSCARIRKPRYCGRLCQKADWKKHRKWCKKDLDLTTPSEADEAMLYNMHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.37
4 0.43
5 0.49
6 0.54
7 0.61
8 0.65
9 0.69
10 0.67
11 0.67
12 0.68
13 0.73
14 0.68
15 0.67
16 0.68
17 0.66
18 0.71
19 0.73
20 0.72
21 0.7
22 0.77
23 0.81
24 0.82
25 0.83
26 0.84
27 0.84
28 0.84
29 0.85
30 0.83
31 0.81
32 0.74
33 0.69
34 0.62
35 0.51
36 0.42
37 0.33
38 0.25
39 0.16
40 0.13
41 0.1
42 0.08