Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0U1LUX9

Protein Details
Accession A0A0U1LUX9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
71-122LDEPKPTKSRLRLRSRSRSRRTTPKSATPKPKTPSPQPPRGRHKRSRSNYENHydrophilic
133-153SSRPRDRYSTPKRQKRFPYNMHydrophilic
NLS Segment(s)
PositionSequence
75-117KPTKSRLRLRSRSRSRRTTPKSATPKPKTPSPQPPRGRHKRSR
Subcellular Location(s) nucl 8.5, cyto_nucl 8, mito 7, cyto 6.5, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLMQSALPCDSRKYLSGPLYRALSPTPPPCDGISGSLMGVSRKLQTLLNVPSGPAPATPPRSMRLASPFHLDEPKPTKSRLRLRSRSRSRRTTPKSATPKPKTPSPQPPRGRHKRSRSNYENGDSDSETDKASSRPRDRYSTPKRQKRFPYNMPLGLGISDFEALEEPIALPHRNILPAADEALPDVVLPSIEWVSSPTPVQRFSLVIDDVALAIVAAAAAAALIITCAVWSSLSQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.44
4 0.44
5 0.44
6 0.45
7 0.43
8 0.4
9 0.35
10 0.31
11 0.31
12 0.35
13 0.35
14 0.33
15 0.35
16 0.34
17 0.36
18 0.32
19 0.28
20 0.24
21 0.19
22 0.18
23 0.17
24 0.16
25 0.13
26 0.13
27 0.12
28 0.11
29 0.12
30 0.13
31 0.13
32 0.15
33 0.22
34 0.24
35 0.29
36 0.27
37 0.26
38 0.26
39 0.26
40 0.24
41 0.17
42 0.17
43 0.17
44 0.22
45 0.25
46 0.26
47 0.27
48 0.29
49 0.3
50 0.29
51 0.3
52 0.29
53 0.28
54 0.31
55 0.3
56 0.3
57 0.34
58 0.31
59 0.31
60 0.32
61 0.37
62 0.34
63 0.35
64 0.39
65 0.43
66 0.53
67 0.57
68 0.62
69 0.65
70 0.73
71 0.82
72 0.87
73 0.89
74 0.87
75 0.87
76 0.83
77 0.84
78 0.82
79 0.81
80 0.76
81 0.75
82 0.77
83 0.76
84 0.8
85 0.75
86 0.76
87 0.69
88 0.7
89 0.66
90 0.64
91 0.67
92 0.64
93 0.67
94 0.68
95 0.74
96 0.77
97 0.82
98 0.83
99 0.81
100 0.84
101 0.84
102 0.83
103 0.84
104 0.79
105 0.76
106 0.71
107 0.65
108 0.56
109 0.46
110 0.41
111 0.3
112 0.26
113 0.2
114 0.16
115 0.13
116 0.11
117 0.11
118 0.11
119 0.16
120 0.23
121 0.27
122 0.33
123 0.37
124 0.42
125 0.45
126 0.54
127 0.59
128 0.62
129 0.68
130 0.7
131 0.71
132 0.74
133 0.81
134 0.8
135 0.8
136 0.77
137 0.76
138 0.73
139 0.71
140 0.64
141 0.54
142 0.44
143 0.34
144 0.26
145 0.15
146 0.09
147 0.07
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.04
155 0.05
156 0.08
157 0.08
158 0.08
159 0.11
160 0.12
161 0.13
162 0.13
163 0.12
164 0.12
165 0.13
166 0.15
167 0.13
168 0.11
169 0.11
170 0.11
171 0.11
172 0.08
173 0.07
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.06
180 0.06
181 0.08
182 0.1
183 0.11
184 0.13
185 0.16
186 0.18
187 0.2
188 0.22
189 0.21
190 0.21
191 0.22
192 0.26
193 0.21
194 0.18
195 0.17
196 0.16
197 0.14
198 0.13
199 0.1
200 0.05
201 0.04
202 0.04
203 0.03
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.03
216 0.04
217 0.04