Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q4WTJ8

Protein Details
Accession Q4WTJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
175-195AEIYAKRERERAKSKKGGKSLBasic
NLS Segment(s)
PositionSequence
180-195KRERERAKSKKGGKSL
Subcellular Location(s) plas 18, E.R. 4, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024960  PEMT/MFAP  
IPR007318  Phopholipid_MeTrfase  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031966  C:mitochondrial membrane  
GO:0080101  F:phosphatidyl-N-dimethylethanolamine N-methyltransferase activity  
GO:0000773  F:phosphatidyl-N-methylethanolamine N-methyltransferase activity  
GO:0032259  P:methylation  
GO:0006656  P:phosphatidylcholine biosynthetic process  
KEGG afm:AFUA_1G09050  -  
Pfam View protein in Pfam  
PF04191  PEMT  
PROSITE View protein in PROSITE  
PS51599  SAM_PEMT_PEM2  
Amino Acid Sequences MCSLHLVQSTVLEDYLLIVANPIPFLLVEYRKHYLTRIFGSPYYGCYFLGFIIFTLGLARDHVYQLALQDQPYYAPVHQPILGSVLFGIGSILVLSSMYALGVTGTYLGDYFGILMDAPVTGFPFNVTGSPMYWGSTLNFLGVALYFGRVAGLLLTAEVFVVYWIALQWEDPFTAEIYAKRERERAKSKKGGKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.06
5 0.06
6 0.07
7 0.08
8 0.08
9 0.07
10 0.06
11 0.06
12 0.08
13 0.13
14 0.16
15 0.19
16 0.25
17 0.28
18 0.29
19 0.3
20 0.31
21 0.31
22 0.32
23 0.33
24 0.32
25 0.32
26 0.31
27 0.35
28 0.33
29 0.31
30 0.28
31 0.25
32 0.2
33 0.17
34 0.17
35 0.13
36 0.13
37 0.1
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.07
44 0.06
45 0.07
46 0.08
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.11
54 0.11
55 0.1
56 0.1
57 0.1
58 0.09
59 0.1
60 0.11
61 0.08
62 0.1
63 0.11
64 0.12
65 0.13
66 0.13
67 0.12
68 0.13
69 0.12
70 0.1
71 0.09
72 0.07
73 0.06
74 0.05
75 0.05
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.06
114 0.07
115 0.07
116 0.07
117 0.1
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.12
124 0.12
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.07
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.05
154 0.05
155 0.07
156 0.08
157 0.09
158 0.09
159 0.1
160 0.1
161 0.12
162 0.13
163 0.14
164 0.18
165 0.25
166 0.28
167 0.3
168 0.37
169 0.41
170 0.5
171 0.58
172 0.63
173 0.67
174 0.74
175 0.8