Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LYZ0

Protein Details
Accession A0A0U1LYZ0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
59-106DINKAYRKKSKELHPDKVKRAFIANNSRQPRDKTKKNKKPGVHVSKGPHydrophilic
242-261AMNRRQKRMMDRESRKENKKBasic
NLS Segment(s)
PositionSequence
65-100RKKSKELHPDKVKRAFIANNSRQPRDKTKKNKKPGV
245-266RRQKRMMDRESRKENKKGSKKE
399-409AKKRGKRNQRK
Subcellular Location(s) extr 8, mito 6, cyto 5.5, E.R. 5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MRHFALQFLVAAVLLVLAAAWTKEDHEIFQLRDEIMVNEGPNVTFYDFLAVKPTASQDDINKAYRKKSKELHPDKVKRAFIANNSRQPRDKTKKNKKPGVHVSKGPSDRQVANAVKEANERSARLNLAANILRGPSRERYDHFLKYGFPKWKGTGYYYSRFRPGLGSVLLGLFVVFGGFGHYIGLVLSYRRQREFMGRYIRHARKAAWGDERGIGGIPGLDAAATTPAPTPVPEPEEAPAAAMNRRQKRMMDRESRKENKKGSKKEAAGGSGTATPTGESTSPGLIGAPVGTKRRVYAENGKVLVVDSVGNVFLEEETEDGDTQEFLLDVDEIPRPQIRDTAVFRLPVWLYRRTVEKLLGKGSAQSAEDEDAAQAAEDDVLEEVEEKQAASTATSASSAKKRGKRNQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.02
5 0.03
6 0.03
7 0.04
8 0.05
9 0.07
10 0.11
11 0.12
12 0.14
13 0.19
14 0.24
15 0.24
16 0.28
17 0.29
18 0.25
19 0.26
20 0.25
21 0.2
22 0.18
23 0.19
24 0.16
25 0.14
26 0.15
27 0.14
28 0.13
29 0.15
30 0.13
31 0.11
32 0.11
33 0.15
34 0.14
35 0.15
36 0.19
37 0.17
38 0.17
39 0.17
40 0.2
41 0.17
42 0.19
43 0.21
44 0.2
45 0.27
46 0.32
47 0.37
48 0.41
49 0.41
50 0.47
51 0.52
52 0.54
53 0.55
54 0.59
55 0.63
56 0.69
57 0.76
58 0.78
59 0.82
60 0.85
61 0.86
62 0.86
63 0.78
64 0.68
65 0.64
66 0.58
67 0.55
68 0.57
69 0.57
70 0.57
71 0.61
72 0.63
73 0.62
74 0.63
75 0.65
76 0.64
77 0.66
78 0.68
79 0.75
80 0.81
81 0.87
82 0.91
83 0.86
84 0.87
85 0.88
86 0.87
87 0.82
88 0.77
89 0.72
90 0.71
91 0.69
92 0.59
93 0.52
94 0.46
95 0.4
96 0.36
97 0.39
98 0.33
99 0.31
100 0.33
101 0.3
102 0.27
103 0.29
104 0.28
105 0.25
106 0.24
107 0.23
108 0.22
109 0.25
110 0.24
111 0.22
112 0.23
113 0.18
114 0.21
115 0.22
116 0.19
117 0.17
118 0.17
119 0.16
120 0.14
121 0.17
122 0.17
123 0.2
124 0.22
125 0.24
126 0.31
127 0.36
128 0.39
129 0.37
130 0.33
131 0.32
132 0.34
133 0.39
134 0.39
135 0.35
136 0.36
137 0.36
138 0.39
139 0.38
140 0.36
141 0.38
142 0.37
143 0.43
144 0.44
145 0.44
146 0.43
147 0.41
148 0.38
149 0.31
150 0.26
151 0.22
152 0.17
153 0.16
154 0.13
155 0.12
156 0.12
157 0.09
158 0.08
159 0.04
160 0.03
161 0.03
162 0.02
163 0.02
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.05
172 0.04
173 0.04
174 0.08
175 0.13
176 0.15
177 0.16
178 0.17
179 0.18
180 0.26
181 0.29
182 0.33
183 0.39
184 0.37
185 0.42
186 0.51
187 0.52
188 0.49
189 0.46
190 0.4
191 0.37
192 0.4
193 0.39
194 0.35
195 0.33
196 0.3
197 0.3
198 0.29
199 0.22
200 0.18
201 0.13
202 0.08
203 0.06
204 0.04
205 0.03
206 0.03
207 0.02
208 0.02
209 0.02
210 0.03
211 0.03
212 0.04
213 0.04
214 0.05
215 0.06
216 0.06
217 0.07
218 0.09
219 0.12
220 0.12
221 0.12
222 0.13
223 0.14
224 0.14
225 0.13
226 0.12
227 0.1
228 0.11
229 0.14
230 0.21
231 0.25
232 0.28
233 0.29
234 0.32
235 0.4
236 0.48
237 0.54
238 0.57
239 0.6
240 0.66
241 0.75
242 0.8
243 0.78
244 0.75
245 0.73
246 0.73
247 0.75
248 0.75
249 0.73
250 0.74
251 0.69
252 0.68
253 0.63
254 0.55
255 0.45
256 0.37
257 0.3
258 0.22
259 0.2
260 0.15
261 0.11
262 0.09
263 0.08
264 0.09
265 0.08
266 0.07
267 0.08
268 0.09
269 0.09
270 0.09
271 0.08
272 0.07
273 0.07
274 0.06
275 0.07
276 0.09
277 0.12
278 0.14
279 0.14
280 0.15
281 0.2
282 0.22
283 0.26
284 0.33
285 0.38
286 0.44
287 0.44
288 0.43
289 0.39
290 0.36
291 0.3
292 0.2
293 0.13
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.07
306 0.07
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.06
313 0.05
314 0.05
315 0.05
316 0.05
317 0.07
318 0.09
319 0.09
320 0.12
321 0.14
322 0.15
323 0.15
324 0.19
325 0.19
326 0.25
327 0.29
328 0.34
329 0.35
330 0.35
331 0.34
332 0.36
333 0.34
334 0.33
335 0.32
336 0.31
337 0.3
338 0.32
339 0.38
340 0.36
341 0.39
342 0.41
343 0.43
344 0.42
345 0.43
346 0.43
347 0.37
348 0.36
349 0.35
350 0.3
351 0.25
352 0.22
353 0.2
354 0.19
355 0.19
356 0.17
357 0.14
358 0.11
359 0.1
360 0.09
361 0.07
362 0.05
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.06
370 0.06
371 0.08
372 0.08
373 0.08
374 0.08
375 0.1
376 0.1
377 0.1
378 0.11
379 0.1
380 0.11
381 0.13
382 0.14
383 0.18
384 0.24
385 0.31
386 0.39
387 0.46
388 0.56
389 0.64