Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WXL1

Protein Details
Accession Q4WXL1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNPNPRHRRDSPRRNRSFAFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007482  Tyr_Pase-like_PTPLA  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0016829  F:lyase activity  
GO:0006633  P:fatty acid biosynthetic process  
KEGG afm:AFUA_3G09890  -  
Pfam View protein in Pfam  
PF04387  PTPLA  
Amino Acid Sequences MNPNPRHRRDSPRRNRSFAFPLPCNAKANPNTGLTRAPIFPTFTQTFTRCVQVWAVNHQSPEPTASSPAYAALLLAWSAADVVRYAYFGLLQAGIRVDFVKWLRPPLRRSTPSGLRSSTSALLYMFLVSLLLLEMGQGANKRMARRFHDVLVHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.77
4 0.74
5 0.71
6 0.68
7 0.59
8 0.56
9 0.56
10 0.56
11 0.51
12 0.44
13 0.44
14 0.39
15 0.41
16 0.38
17 0.36
18 0.35
19 0.33
20 0.33
21 0.27
22 0.26
23 0.23
24 0.22
25 0.19
26 0.21
27 0.2
28 0.25
29 0.25
30 0.25
31 0.28
32 0.27
33 0.29
34 0.27
35 0.3
36 0.23
37 0.22
38 0.22
39 0.22
40 0.22
41 0.25
42 0.29
43 0.27
44 0.27
45 0.26
46 0.24
47 0.2
48 0.21
49 0.16
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.09
57 0.07
58 0.06
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.09
86 0.09
87 0.15
88 0.15
89 0.23
90 0.28
91 0.34
92 0.39
93 0.44
94 0.54
95 0.52
96 0.57
97 0.59
98 0.62
99 0.61
100 0.62
101 0.54
102 0.45
103 0.43
104 0.4
105 0.34
106 0.25
107 0.2
108 0.16
109 0.15
110 0.14
111 0.12
112 0.09
113 0.06
114 0.06
115 0.05
116 0.05
117 0.04
118 0.04
119 0.03
120 0.03
121 0.04
122 0.04
123 0.06
124 0.07
125 0.09
126 0.14
127 0.18
128 0.23
129 0.28
130 0.36
131 0.41
132 0.48
133 0.51
134 0.5