Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LNM5

Protein Details
Accession A0A0U1LNM5    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-86SAYTKVSKTKRKVPSRKHGSESRHydrophilic
159-179SDNASSKKRAKARKQGGLQALHydrophilic
NLS Segment(s)
PositionSequence
73-76KRKV
165-172KKRAKARK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAANESALRLKFLQNSANLLSKSGVSTAAHLMTLHNRLIHADSKPLKPRQHESWCGACGTPRDSAYTKVSKTKRKVPSRKHGSESRYALEEAVVYHCLRCHKQTIRRLQSYVRQQCEPSSNSIDAQPKAAPTNQHLSPPSTTPGPSSSVSSTSTVKPASDNASSKKRAKARKQGGLQALMASKQRSQASNAGSSLDLLDFLQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.34
4 0.38
5 0.35
6 0.31
7 0.28
8 0.24
9 0.22
10 0.18
11 0.18
12 0.12
13 0.14
14 0.15
15 0.15
16 0.15
17 0.14
18 0.15
19 0.17
20 0.2
21 0.19
22 0.17
23 0.16
24 0.17
25 0.2
26 0.23
27 0.19
28 0.25
29 0.28
30 0.35
31 0.43
32 0.49
33 0.51
34 0.53
35 0.58
36 0.6
37 0.65
38 0.64
39 0.61
40 0.6
41 0.56
42 0.51
43 0.44
44 0.37
45 0.3
46 0.25
47 0.23
48 0.18
49 0.2
50 0.21
51 0.24
52 0.27
53 0.3
54 0.3
55 0.36
56 0.42
57 0.47
58 0.51
59 0.57
60 0.62
61 0.68
62 0.76
63 0.78
64 0.82
65 0.83
66 0.84
67 0.8
68 0.77
69 0.7
70 0.68
71 0.61
72 0.51
73 0.43
74 0.36
75 0.3
76 0.23
77 0.19
78 0.11
79 0.1
80 0.09
81 0.07
82 0.07
83 0.09
84 0.11
85 0.12
86 0.14
87 0.19
88 0.25
89 0.34
90 0.42
91 0.51
92 0.57
93 0.59
94 0.59
95 0.55
96 0.55
97 0.57
98 0.57
99 0.49
100 0.42
101 0.4
102 0.41
103 0.42
104 0.36
105 0.3
106 0.26
107 0.23
108 0.23
109 0.26
110 0.28
111 0.24
112 0.24
113 0.21
114 0.18
115 0.19
116 0.2
117 0.18
118 0.17
119 0.22
120 0.21
121 0.25
122 0.26
123 0.27
124 0.27
125 0.27
126 0.26
127 0.22
128 0.21
129 0.18
130 0.19
131 0.19
132 0.18
133 0.19
134 0.18
135 0.19
136 0.21
137 0.21
138 0.22
139 0.19
140 0.22
141 0.2
142 0.18
143 0.17
144 0.18
145 0.21
146 0.24
147 0.27
148 0.3
149 0.38
150 0.43
151 0.47
152 0.52
153 0.56
154 0.61
155 0.67
156 0.72
157 0.74
158 0.78
159 0.8
160 0.81
161 0.79
162 0.72
163 0.62
164 0.54
165 0.45
166 0.37
167 0.34
168 0.27
169 0.22
170 0.25
171 0.28
172 0.26
173 0.3
174 0.34
175 0.35
176 0.39
177 0.37
178 0.33
179 0.3
180 0.28
181 0.25
182 0.19
183 0.14