Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0U1M4B0

Protein Details
Accession A0A0U1M4B0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-109YEKMAEKMHHKRVERRKRREKRNKLLNSBasic
NLS Segment(s)
PositionSequence
50-105RERELKEEKQAERDRHIQAIKERRAAKEEKERYEKMAEKMHHKRVERRKRREKRNK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSTAPKPVGMRQNGKNWHANKKAFRPTAGLKSYAKRQEDRVNLANIKERERELKEEKQAERDRHIQAIKERRAAKEEKERYEKMAEKMHHKRVERRKRREKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.65
4 0.61
5 0.63
6 0.64
7 0.65
8 0.64
9 0.66
10 0.72
11 0.66
12 0.63
13 0.59
14 0.56
15 0.58
16 0.52
17 0.46
18 0.39
19 0.4
20 0.47
21 0.48
22 0.46
23 0.39
24 0.42
25 0.46
26 0.48
27 0.51
28 0.47
29 0.44
30 0.42
31 0.41
32 0.43
33 0.35
34 0.33
35 0.29
36 0.26
37 0.26
38 0.27
39 0.32
40 0.31
41 0.36
42 0.39
43 0.44
44 0.43
45 0.47
46 0.51
47 0.47
48 0.46
49 0.46
50 0.42
51 0.41
52 0.41
53 0.35
54 0.37
55 0.45
56 0.44
57 0.45
58 0.46
59 0.43
60 0.46
61 0.45
62 0.45
63 0.46
64 0.5
65 0.51
66 0.56
67 0.55
68 0.54
69 0.59
70 0.57
71 0.51
72 0.51
73 0.46
74 0.49
75 0.57
76 0.63
77 0.63
78 0.63
79 0.68
80 0.71
81 0.79
82 0.8
83 0.82
84 0.84
85 0.88
86 0.94
87 0.96
88 0.96
89 0.95