Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0U1LKL4

Protein Details
Accession A0A0U1LKL4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-78EKSTKAEKRRIRVEKSQTEKISHydrophilic
NLS Segment(s)
PositionSequence
63-66EKRR
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MIKSSGERELELHNVPRVKEIEDDKAADDEERRERLKTTASDSDLTPGQRVRKEELEKSTKAEKRRIRVEKSQTEKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.29
5 0.26
6 0.28
7 0.28
8 0.3
9 0.3
10 0.3
11 0.27
12 0.26
13 0.25
14 0.2
15 0.18
16 0.15
17 0.18
18 0.2
19 0.2
20 0.2
21 0.21
22 0.22
23 0.26
24 0.24
25 0.25
26 0.25
27 0.26
28 0.27
29 0.26
30 0.26
31 0.23
32 0.22
33 0.18
34 0.16
35 0.18
36 0.2
37 0.22
38 0.25
39 0.31
40 0.36
41 0.41
42 0.47
43 0.49
44 0.47
45 0.49
46 0.54
47 0.5
48 0.51
49 0.55
50 0.54
51 0.56
52 0.66
53 0.71
54 0.69
55 0.75
56 0.79
57 0.8
58 0.81