Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1MAF4

Protein Details
Accession A0A0U1MAF4    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
9-33VPTSADPKSKRPIKRRQLTPVSEQAHydrophilic
120-153IQRKDDEKTDKNRKKREKRKAAAARNKNNKKANGBasic
NLS Segment(s)
PositionSequence
115-150KKKSEIQRKDDEKTDKNRKKREKRKAAAARNKNNKK
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPGKDSVPTSADPKSKRPIKRRQLTPVSEQADQINSLFKDPSKEIRLPNASKHRTADSLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMDEEVKREKADEAYEKKKSEIQRKDDEKTDKNRKKREKRKAAAARNKNNKKANGNTDSMNVDNDHEAGPRKVPRLGALPPRGTDRDSEANGDHDQQAYEEQGIIIHDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.48
4 0.53
5 0.61
6 0.68
7 0.72
8 0.76
9 0.83
10 0.86
11 0.87
12 0.88
13 0.84
14 0.81
15 0.79
16 0.72
17 0.63
18 0.54
19 0.45
20 0.37
21 0.32
22 0.25
23 0.21
24 0.17
25 0.17
26 0.17
27 0.16
28 0.19
29 0.21
30 0.28
31 0.29
32 0.33
33 0.34
34 0.42
35 0.5
36 0.47
37 0.54
38 0.57
39 0.55
40 0.54
41 0.54
42 0.48
43 0.42
44 0.41
45 0.38
46 0.34
47 0.38
48 0.36
49 0.33
50 0.3
51 0.28
52 0.27
53 0.2
54 0.15
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.2
75 0.27
76 0.31
77 0.35
78 0.42
79 0.5
80 0.57
81 0.62
82 0.62
83 0.57
84 0.53
85 0.5
86 0.46
87 0.42
88 0.36
89 0.32
90 0.26
91 0.24
92 0.22
93 0.22
94 0.21
95 0.16
96 0.18
97 0.2
98 0.24
99 0.3
100 0.34
101 0.34
102 0.34
103 0.38
104 0.41
105 0.44
106 0.47
107 0.47
108 0.53
109 0.58
110 0.6
111 0.63
112 0.63
113 0.6
114 0.61
115 0.66
116 0.64
117 0.67
118 0.74
119 0.78
120 0.83
121 0.87
122 0.88
123 0.88
124 0.87
125 0.89
126 0.9
127 0.9
128 0.89
129 0.89
130 0.88
131 0.87
132 0.89
133 0.86
134 0.82
135 0.78
136 0.74
137 0.72
138 0.71
139 0.65
140 0.59
141 0.52
142 0.48
143 0.44
144 0.37
145 0.3
146 0.21
147 0.17
148 0.15
149 0.15
150 0.13
151 0.12
152 0.14
153 0.14
154 0.19
155 0.22
156 0.24
157 0.26
158 0.26
159 0.27
160 0.3
161 0.36
162 0.41
163 0.44
164 0.45
165 0.44
166 0.48
167 0.47
168 0.43
169 0.38
170 0.35
171 0.34
172 0.33
173 0.35
174 0.3
175 0.32
176 0.32
177 0.33
178 0.28
179 0.21
180 0.2
181 0.17
182 0.18
183 0.16
184 0.15
185 0.13
186 0.11
187 0.11