Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WXP3

Protein Details
Accession Q4WXP3    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
185-217SDRVIMAYPKKARKRGRRSRKEAMSRRKGTKSEBasic
NLS Segment(s)
PositionSequence
193-215PKKARKRGRRSRKEAMSRRKGTK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
KEGG afm:AFUA_3G10210  -  
Amino Acid Sequences MGAASSRRLQPHSALQGIEEEVQTEGTDDIDGNDQGQILGNEIPVMRIAKLRHNPKARQGDQGEVQHIQFVDHSSDISLHGKQPFRRGEWKPDAPEFIPIPQQRVAMQQVERQQDLGVKETQRHGLDDERDLSRTVNSQMGKSAVPSFPITNENESPRPAASTKHRSHAAEGGSSQFTAGSRQASDRVIMAYPKKARKRGRRSRKEAMSRRKGTKSEPAGIGLTTDIDHSSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.35
4 0.34
5 0.31
6 0.21
7 0.15
8 0.12
9 0.12
10 0.11
11 0.1
12 0.08
13 0.07
14 0.07
15 0.06
16 0.07
17 0.1
18 0.1
19 0.09
20 0.1
21 0.09
22 0.09
23 0.1
24 0.09
25 0.08
26 0.09
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.09
34 0.13
35 0.15
36 0.23
37 0.32
38 0.4
39 0.48
40 0.55
41 0.59
42 0.65
43 0.74
44 0.67
45 0.67
46 0.61
47 0.57
48 0.54
49 0.53
50 0.46
51 0.36
52 0.34
53 0.27
54 0.24
55 0.19
56 0.14
57 0.12
58 0.11
59 0.1
60 0.1
61 0.08
62 0.09
63 0.1
64 0.12
65 0.11
66 0.13
67 0.18
68 0.22
69 0.24
70 0.31
71 0.33
72 0.36
73 0.44
74 0.44
75 0.49
76 0.54
77 0.58
78 0.54
79 0.52
80 0.5
81 0.42
82 0.42
83 0.33
84 0.25
85 0.27
86 0.23
87 0.24
88 0.23
89 0.23
90 0.19
91 0.22
92 0.23
93 0.19
94 0.2
95 0.21
96 0.25
97 0.27
98 0.26
99 0.23
100 0.21
101 0.2
102 0.2
103 0.19
104 0.16
105 0.14
106 0.15
107 0.17
108 0.21
109 0.18
110 0.18
111 0.17
112 0.18
113 0.2
114 0.2
115 0.21
116 0.18
117 0.18
118 0.18
119 0.17
120 0.13
121 0.13
122 0.13
123 0.15
124 0.15
125 0.14
126 0.15
127 0.16
128 0.16
129 0.15
130 0.17
131 0.12
132 0.14
133 0.15
134 0.14
135 0.14
136 0.18
137 0.18
138 0.19
139 0.21
140 0.24
141 0.24
142 0.24
143 0.24
144 0.21
145 0.22
146 0.18
147 0.21
148 0.26
149 0.34
150 0.36
151 0.41
152 0.46
153 0.44
154 0.47
155 0.47
156 0.4
157 0.32
158 0.3
159 0.26
160 0.22
161 0.21
162 0.18
163 0.13
164 0.11
165 0.12
166 0.12
167 0.11
168 0.12
169 0.13
170 0.16
171 0.16
172 0.17
173 0.15
174 0.16
175 0.15
176 0.19
177 0.2
178 0.25
179 0.32
180 0.41
181 0.48
182 0.55
183 0.64
184 0.71
185 0.8
186 0.83
187 0.87
188 0.89
189 0.91
190 0.92
191 0.93
192 0.93
193 0.92
194 0.92
195 0.91
196 0.89
197 0.88
198 0.85
199 0.78
200 0.73
201 0.72
202 0.69
203 0.66
204 0.59
205 0.54
206 0.47
207 0.43
208 0.38
209 0.28
210 0.21
211 0.13
212 0.12