Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WE38

Protein Details
Accession Q4WE38    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
173-193LNTLAARRYRQRRVDRMNELEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG afm:AFUA_5G01650  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
Amino Acid Sequences MSVTAIFVQVARQTGPVFFQPQQRAYPTPAFCSPHFVFPDTTLDLASFAPDPSVSDTDPSAFVPLPPDLASFGDLDHASLPTGTSSSPYVPDSFDVTAISTPAVDVNDSLPCLDIDSSGTDSDTQIDPGQIHTLTPPLLMPASRPQRVSISAASTAKDNPPKETPNRVLKRQLNTLAARRYRQRRVDRMNELEAELEKVKRERDELKMRVSKLEGETEALRGLLKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.22
5 0.24
6 0.32
7 0.37
8 0.39
9 0.43
10 0.45
11 0.44
12 0.45
13 0.5
14 0.43
15 0.42
16 0.44
17 0.44
18 0.4
19 0.45
20 0.41
21 0.4
22 0.4
23 0.37
24 0.32
25 0.3
26 0.35
27 0.27
28 0.26
29 0.19
30 0.17
31 0.15
32 0.14
33 0.13
34 0.09
35 0.07
36 0.07
37 0.07
38 0.08
39 0.11
40 0.13
41 0.12
42 0.13
43 0.13
44 0.14
45 0.15
46 0.14
47 0.12
48 0.1
49 0.1
50 0.12
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.11
58 0.09
59 0.09
60 0.1
61 0.09
62 0.09
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.09
75 0.1
76 0.11
77 0.11
78 0.12
79 0.13
80 0.12
81 0.12
82 0.1
83 0.1
84 0.09
85 0.09
86 0.08
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.06
100 0.06
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.09
110 0.08
111 0.08
112 0.07
113 0.08
114 0.08
115 0.08
116 0.1
117 0.08
118 0.08
119 0.07
120 0.08
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.08
128 0.15
129 0.22
130 0.24
131 0.25
132 0.26
133 0.28
134 0.31
135 0.32
136 0.25
137 0.21
138 0.23
139 0.23
140 0.22
141 0.21
142 0.2
143 0.22
144 0.27
145 0.25
146 0.25
147 0.29
148 0.35
149 0.39
150 0.46
151 0.49
152 0.53
153 0.59
154 0.6
155 0.64
156 0.65
157 0.66
158 0.65
159 0.62
160 0.58
161 0.56
162 0.58
163 0.57
164 0.55
165 0.54
166 0.55
167 0.59
168 0.62
169 0.67
170 0.7
171 0.72
172 0.77
173 0.82
174 0.82
175 0.79
176 0.75
177 0.66
178 0.57
179 0.48
180 0.39
181 0.33
182 0.26
183 0.2
184 0.19
185 0.2
186 0.23
187 0.24
188 0.28
189 0.31
190 0.38
191 0.48
192 0.5
193 0.57
194 0.61
195 0.6
196 0.59
197 0.55
198 0.51
199 0.44
200 0.44
201 0.35
202 0.32
203 0.32
204 0.29
205 0.27
206 0.22
207 0.19
208 0.15