Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LKB0

Protein Details
Accession A0A0U1LKB0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-39GLLWKIPWRLSPRQKFRQRRRLRAVDTVVHydrophilic
75-103KYTIYDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
82-94KEKKYRKGIHKLP
Subcellular Location(s) mito 23, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTLPRLGGLLWKIPWRLSPRQKFRQRRRLRAVDTVVDTVAAALKRNGMPMVKAIDRWYDEMPREQEMLPKDKYTIYDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.28
4 0.31
5 0.33
6 0.41
7 0.47
8 0.55
9 0.61
10 0.71
11 0.81
12 0.86
13 0.9
14 0.91
15 0.91
16 0.91
17 0.91
18 0.91
19 0.85
20 0.83
21 0.76
22 0.69
23 0.61
24 0.51
25 0.41
26 0.31
27 0.25
28 0.16
29 0.14
30 0.09
31 0.07
32 0.06
33 0.08
34 0.09
35 0.09
36 0.1
37 0.08
38 0.09
39 0.1
40 0.13
41 0.12
42 0.12
43 0.13
44 0.14
45 0.15
46 0.17
47 0.17
48 0.16
49 0.17
50 0.22
51 0.22
52 0.22
53 0.22
54 0.2
55 0.22
56 0.23
57 0.27
58 0.24
59 0.22
60 0.22
61 0.21
62 0.24
63 0.27
64 0.32
65 0.31
66 0.4
67 0.44
68 0.53
69 0.62
70 0.67
71 0.7
72 0.73
73 0.79
74 0.8
75 0.86
76 0.86
77 0.87
78 0.88
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79