Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WMM7

Protein Details
Accession Q4WMM7   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAKPRKIRHRQSNKPKAKHQQHKRRGDTLFBasic
NLS Segment(s)
PositionSequence
3-25KPRKIRHRQSNKPKAKHQQHKRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG afm:AFUA_6G09356  -  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAKPRKIRHRQSNKPKAKHQQHKRRGDTLFRKAFEYCQECNADVSLVVRLKDNGQIYIFNSDNRWFPSEEGLEILDYTNRHKTLHYPVPLRITWQELAAAYEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.91
5 0.9
6 0.9
7 0.9
8 0.9
9 0.92
10 0.89
11 0.86
12 0.79
13 0.79
14 0.77
15 0.76
16 0.73
17 0.63
18 0.59
19 0.51
20 0.49
21 0.46
22 0.41
23 0.32
24 0.29
25 0.29
26 0.28
27 0.27
28 0.25
29 0.18
30 0.13
31 0.12
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.14
39 0.14
40 0.12
41 0.12
42 0.12
43 0.13
44 0.17
45 0.17
46 0.13
47 0.14
48 0.14
49 0.16
50 0.17
51 0.18
52 0.15
53 0.15
54 0.19
55 0.19
56 0.18
57 0.17
58 0.15
59 0.13
60 0.12
61 0.12
62 0.09
63 0.09
64 0.12
65 0.17
66 0.17
67 0.18
68 0.18
69 0.23
70 0.31
71 0.39
72 0.44
73 0.42
74 0.45
75 0.51
76 0.5
77 0.5
78 0.43
79 0.39
80 0.32
81 0.29
82 0.26
83 0.21