Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BWM8

Protein Details
Accession Q6BWM8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-33KWAKQNTKKQGQPRKEGKKSBasic
NLS Segment(s)
PositionSequence
16-32AKQNTKKQGQPRKEGKK
Subcellular Location(s) mito 14, plas 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG dha:DEHA2B10098g  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAQQTPKQRAANAKWAKQNTKKQGQPRKEGKKSEFPVSRTWLLVLLFLVCGGAILELIRMFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.71
4 0.7
5 0.74
6 0.73
7 0.74
8 0.74
9 0.76
10 0.79
11 0.78
12 0.78
13 0.79
14 0.8
15 0.78
16 0.79
17 0.73
18 0.73
19 0.69
20 0.68
21 0.62
22 0.54
23 0.52
24 0.5
25 0.47
26 0.37
27 0.34
28 0.27
29 0.21
30 0.2
31 0.15
32 0.1
33 0.08
34 0.08
35 0.07
36 0.05
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.05