Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LVA5

Protein Details
Accession A0A0U1LVA5    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
317-343EESEQKHREFEKRRKKHYEMKNIKDLLBasic
NLS Segment(s)
PositionSequence
328-332KRRKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007062  PPI-2  
Gene Ontology GO:0004864  F:protein phosphatase inhibitor activity  
GO:0043666  P:regulation of phosphoprotein phosphatase activity  
GO:0009966  P:regulation of signal transduction  
Pfam View protein in Pfam  
PF04979  IPP-2  
Amino Acid Sequences MPQNTRNSLSPSDPALPNPPLYRDSIPAHARFSLVSQQLVTTQLSPCAIPAFRLERVHIPIDFYPAALGSFAPCLPNMTASQGVAPVNSQSSEEVPKRPKGILKNSCSFTAATQLATSPEASAISPPALPADSAENKDITLQNTLQNAGRRSSSARRTSAGRRLSGISFSGDQSDDRSSHLKWDEANLYLAEQEKTAKMKIDEPKTPWAPSYDPSQDDHDEMQIEAQDRTLDAHDLVVDELDKKTEGGHSKNSVKDSEIPDFELGEPEENFHAAGPSAGESRIMRERSLSQNSNRSDKHVVVNNEESNRNDHLMTTEESEQKHREFEKRRKKHYEMKNIKDLLAHPEEVDKMEDDDDENDTGVPPMPDRKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.37
4 0.37
5 0.37
6 0.35
7 0.31
8 0.35
9 0.34
10 0.33
11 0.35
12 0.39
13 0.43
14 0.42
15 0.43
16 0.39
17 0.36
18 0.31
19 0.31
20 0.3
21 0.26
22 0.25
23 0.22
24 0.22
25 0.22
26 0.24
27 0.22
28 0.16
29 0.15
30 0.16
31 0.16
32 0.16
33 0.15
34 0.17
35 0.16
36 0.15
37 0.19
38 0.22
39 0.26
40 0.28
41 0.3
42 0.32
43 0.36
44 0.38
45 0.33
46 0.32
47 0.28
48 0.32
49 0.29
50 0.23
51 0.19
52 0.16
53 0.16
54 0.12
55 0.11
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.11
62 0.11
63 0.13
64 0.13
65 0.15
66 0.16
67 0.15
68 0.16
69 0.15
70 0.15
71 0.13
72 0.13
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.11
79 0.18
80 0.2
81 0.26
82 0.3
83 0.34
84 0.36
85 0.38
86 0.41
87 0.43
88 0.52
89 0.54
90 0.56
91 0.59
92 0.59
93 0.57
94 0.53
95 0.45
96 0.34
97 0.31
98 0.25
99 0.18
100 0.16
101 0.15
102 0.15
103 0.15
104 0.14
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.12
119 0.14
120 0.16
121 0.17
122 0.16
123 0.16
124 0.19
125 0.2
126 0.15
127 0.16
128 0.15
129 0.17
130 0.18
131 0.2
132 0.2
133 0.22
134 0.22
135 0.2
136 0.2
137 0.17
138 0.21
139 0.27
140 0.33
141 0.35
142 0.35
143 0.36
144 0.4
145 0.45
146 0.49
147 0.46
148 0.39
149 0.34
150 0.35
151 0.34
152 0.3
153 0.25
154 0.18
155 0.14
156 0.14
157 0.13
158 0.11
159 0.1
160 0.11
161 0.12
162 0.1
163 0.11
164 0.13
165 0.12
166 0.17
167 0.18
168 0.17
169 0.15
170 0.18
171 0.18
172 0.17
173 0.18
174 0.13
175 0.12
176 0.12
177 0.13
178 0.09
179 0.08
180 0.08
181 0.08
182 0.1
183 0.1
184 0.12
185 0.11
186 0.18
187 0.25
188 0.3
189 0.33
190 0.35
191 0.42
192 0.42
193 0.41
194 0.35
195 0.31
196 0.27
197 0.24
198 0.27
199 0.23
200 0.23
201 0.24
202 0.27
203 0.26
204 0.26
205 0.25
206 0.19
207 0.16
208 0.14
209 0.13
210 0.11
211 0.11
212 0.09
213 0.09
214 0.08
215 0.07
216 0.09
217 0.09
218 0.08
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.07
232 0.11
233 0.16
234 0.18
235 0.24
236 0.3
237 0.35
238 0.38
239 0.4
240 0.36
241 0.34
242 0.37
243 0.36
244 0.35
245 0.3
246 0.29
247 0.27
248 0.27
249 0.25
250 0.21
251 0.16
252 0.13
253 0.12
254 0.12
255 0.12
256 0.11
257 0.1
258 0.08
259 0.08
260 0.06
261 0.06
262 0.06
263 0.07
264 0.07
265 0.07
266 0.09
267 0.09
268 0.13
269 0.2
270 0.21
271 0.2
272 0.22
273 0.27
274 0.33
275 0.41
276 0.43
277 0.42
278 0.49
279 0.53
280 0.58
281 0.54
282 0.51
283 0.47
284 0.44
285 0.45
286 0.44
287 0.44
288 0.42
289 0.48
290 0.47
291 0.47
292 0.46
293 0.41
294 0.37
295 0.37
296 0.32
297 0.26
298 0.21
299 0.19
300 0.2
301 0.2
302 0.21
303 0.24
304 0.25
305 0.27
306 0.31
307 0.33
308 0.31
309 0.36
310 0.36
311 0.41
312 0.48
313 0.57
314 0.64
315 0.71
316 0.8
317 0.83
318 0.87
319 0.87
320 0.88
321 0.88
322 0.88
323 0.86
324 0.86
325 0.78
326 0.7
327 0.64
328 0.54
329 0.51
330 0.45
331 0.37
332 0.27
333 0.28
334 0.28
335 0.26
336 0.26
337 0.19
338 0.16
339 0.16
340 0.16
341 0.15
342 0.15
343 0.16
344 0.15
345 0.15
346 0.13
347 0.13
348 0.13
349 0.14
350 0.13
351 0.13