Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WVX1

Protein Details
Accession Q4WVX1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
54-73SKKSKARAKTRAQRLRQQKGHydrophilic
NLS Segment(s)
PositionSequence
54-75SKKSKARAKTRAQRLRQQKGIE
85-99EKKVAKSVSRAKIVK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG afm:AFUA_5G13610  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKARPKSIHSRAARRAASPSLDVDKSLTSLPRAENTVIQRESVLSERANAGVSKKSKARAKTRAQRLRQQKGIERAEMVYSRLEKKVAKSVSRAKIVKARRSDWESLNRNVSGSMFEALQERDDTRLDDAMIDVAGAPATKKRTSKPAEATQNPVADEHADIDVDDDIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.65
3 0.62
4 0.56
5 0.5
6 0.42
7 0.37
8 0.33
9 0.31
10 0.3
11 0.26
12 0.22
13 0.2
14 0.2
15 0.17
16 0.13
17 0.16
18 0.18
19 0.19
20 0.21
21 0.21
22 0.24
23 0.27
24 0.33
25 0.31
26 0.29
27 0.27
28 0.24
29 0.25
30 0.22
31 0.2
32 0.12
33 0.13
34 0.14
35 0.14
36 0.15
37 0.13
38 0.13
39 0.17
40 0.19
41 0.21
42 0.23
43 0.3
44 0.34
45 0.42
46 0.5
47 0.53
48 0.62
49 0.68
50 0.76
51 0.79
52 0.79
53 0.8
54 0.81
55 0.79
56 0.74
57 0.69
58 0.64
59 0.64
60 0.61
61 0.53
62 0.43
63 0.36
64 0.32
65 0.27
66 0.22
67 0.14
68 0.13
69 0.14
70 0.14
71 0.15
72 0.14
73 0.16
74 0.22
75 0.25
76 0.24
77 0.28
78 0.37
79 0.41
80 0.48
81 0.46
82 0.41
83 0.45
84 0.49
85 0.51
86 0.47
87 0.44
88 0.42
89 0.47
90 0.49
91 0.47
92 0.5
93 0.48
94 0.46
95 0.47
96 0.41
97 0.35
98 0.32
99 0.27
100 0.18
101 0.15
102 0.12
103 0.08
104 0.08
105 0.1
106 0.1
107 0.11
108 0.11
109 0.1
110 0.11
111 0.12
112 0.13
113 0.12
114 0.13
115 0.12
116 0.11
117 0.11
118 0.09
119 0.08
120 0.07
121 0.05
122 0.05
123 0.05
124 0.04
125 0.05
126 0.08
127 0.12
128 0.17
129 0.2
130 0.24
131 0.34
132 0.41
133 0.5
134 0.55
135 0.61
136 0.67
137 0.68
138 0.71
139 0.67
140 0.63
141 0.54
142 0.46
143 0.37
144 0.27
145 0.24
146 0.19
147 0.14
148 0.11
149 0.1
150 0.11