Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0U1LN28

Protein Details
Accession A0A0U1LN28    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
72-95ESFGRRAWLEKRRRDKKALEQLENHydrophilic
NLS Segment(s)
PositionSequence
81-87EKRRRDK
Subcellular Location(s) nucl 9, mito 8, cyto_nucl 8, cyto 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028590  RNA_methyltr_E_TRM7  
IPR002877  RNA_MeTrfase_FtsJ_dom  
IPR015507  rRNA-MeTfrase_E  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0106339  F:tRNA (cytidine 32-2'-O)-methyltransferase activity  
GO:0002181  P:cytoplasmic translation  
GO:0002128  P:tRNA nucleoside ribose methylation  
Pfam View protein in Pfam  
PF01728  FtsJ  
Amino Acid Sequences MGKASKDKRDAYYRLAKEQNWRARSAFKLIQIDEQFDLFSHTDPESVTRVVDLCAAPGSWSQVLSRVLIKGESFGRRAWLEKRRRDKKALEQLENGGDVVPGGQETGEDEADESKILKPRKNVKIVSIDLQPMAPLEGITILKADITHPSTIPLLLRALDPEDYEQASAEQEKSGSSLPSRHPHPVDLVISDGAPDVTGLHDLDIYIQSQLLYAALNLTIGVLRPGGKFVAKIFRGRDVDLLYAQLRTVFQKVSVAKPRSSRASSLEAFVVCEGFMPPADSDPAHALQNPIFGGAANPPVNQDGTVGAEIPADYDENDQQSKQAEPIITDTTTSADESRTVQTRLLEQLSISETAGHRQPDESRWIPAFIACGDLSAWDSDASYALPEGYITLDPVQPPTAPPYKKALEMRKEMGGAYGKTKLGQMGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.62
4 0.63
5 0.69
6 0.7
7 0.63
8 0.62
9 0.56
10 0.56
11 0.56
12 0.54
13 0.49
14 0.46
15 0.5
16 0.47
17 0.53
18 0.49
19 0.48
20 0.41
21 0.36
22 0.29
23 0.22
24 0.24
25 0.16
26 0.15
27 0.15
28 0.14
29 0.14
30 0.15
31 0.18
32 0.17
33 0.17
34 0.16
35 0.14
36 0.15
37 0.14
38 0.18
39 0.15
40 0.12
41 0.13
42 0.13
43 0.13
44 0.13
45 0.16
46 0.13
47 0.14
48 0.13
49 0.18
50 0.19
51 0.19
52 0.21
53 0.18
54 0.19
55 0.19
56 0.19
57 0.17
58 0.21
59 0.24
60 0.23
61 0.23
62 0.26
63 0.26
64 0.3
65 0.35
66 0.39
67 0.45
68 0.54
69 0.64
70 0.7
71 0.77
72 0.81
73 0.81
74 0.82
75 0.83
76 0.82
77 0.77
78 0.7
79 0.66
80 0.6
81 0.52
82 0.4
83 0.29
84 0.19
85 0.13
86 0.1
87 0.07
88 0.04
89 0.04
90 0.04
91 0.03
92 0.05
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.09
100 0.09
101 0.1
102 0.16
103 0.2
104 0.24
105 0.31
106 0.41
107 0.5
108 0.58
109 0.57
110 0.57
111 0.62
112 0.6
113 0.56
114 0.49
115 0.41
116 0.32
117 0.3
118 0.24
119 0.15
120 0.13
121 0.09
122 0.06
123 0.05
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.07
132 0.09
133 0.11
134 0.12
135 0.12
136 0.14
137 0.14
138 0.15
139 0.14
140 0.11
141 0.1
142 0.09
143 0.09
144 0.09
145 0.1
146 0.09
147 0.1
148 0.1
149 0.11
150 0.1
151 0.1
152 0.1
153 0.08
154 0.09
155 0.09
156 0.09
157 0.07
158 0.07
159 0.07
160 0.08
161 0.09
162 0.09
163 0.09
164 0.13
165 0.17
166 0.23
167 0.26
168 0.29
169 0.3
170 0.3
171 0.31
172 0.3
173 0.27
174 0.21
175 0.2
176 0.15
177 0.13
178 0.12
179 0.1
180 0.06
181 0.05
182 0.04
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.04
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.04
210 0.05
211 0.05
212 0.06
213 0.07
214 0.07
215 0.08
216 0.09
217 0.17
218 0.17
219 0.21
220 0.21
221 0.27
222 0.29
223 0.29
224 0.29
225 0.23
226 0.22
227 0.19
228 0.2
229 0.13
230 0.12
231 0.11
232 0.09
233 0.08
234 0.09
235 0.1
236 0.09
237 0.08
238 0.14
239 0.16
240 0.22
241 0.31
242 0.33
243 0.34
244 0.38
245 0.42
246 0.43
247 0.43
248 0.38
249 0.33
250 0.36
251 0.34
252 0.31
253 0.29
254 0.23
255 0.21
256 0.19
257 0.15
258 0.08
259 0.08
260 0.07
261 0.05
262 0.05
263 0.06
264 0.06
265 0.07
266 0.08
267 0.08
268 0.09
269 0.11
270 0.13
271 0.12
272 0.12
273 0.13
274 0.12
275 0.15
276 0.13
277 0.11
278 0.09
279 0.08
280 0.09
281 0.09
282 0.14
283 0.13
284 0.13
285 0.13
286 0.14
287 0.15
288 0.14
289 0.13
290 0.08
291 0.1
292 0.1
293 0.09
294 0.08
295 0.08
296 0.08
297 0.08
298 0.08
299 0.06
300 0.06
301 0.08
302 0.1
303 0.12
304 0.14
305 0.13
306 0.14
307 0.15
308 0.16
309 0.14
310 0.16
311 0.14
312 0.14
313 0.18
314 0.2
315 0.18
316 0.18
317 0.17
318 0.15
319 0.15
320 0.15
321 0.12
322 0.09
323 0.1
324 0.13
325 0.17
326 0.19
327 0.19
328 0.21
329 0.22
330 0.24
331 0.28
332 0.27
333 0.23
334 0.19
335 0.2
336 0.21
337 0.2
338 0.17
339 0.15
340 0.14
341 0.17
342 0.21
343 0.2
344 0.18
345 0.2
346 0.23
347 0.24
348 0.32
349 0.31
350 0.32
351 0.32
352 0.33
353 0.31
354 0.28
355 0.26
356 0.18
357 0.19
358 0.14
359 0.13
360 0.12
361 0.12
362 0.12
363 0.11
364 0.11
365 0.08
366 0.08
367 0.08
368 0.08
369 0.08
370 0.07
371 0.07
372 0.06
373 0.06
374 0.06
375 0.06
376 0.08
377 0.08
378 0.09
379 0.11
380 0.13
381 0.14
382 0.16
383 0.17
384 0.16
385 0.17
386 0.23
387 0.3
388 0.29
389 0.32
390 0.38
391 0.39
392 0.46
393 0.54
394 0.57
395 0.57
396 0.63
397 0.64
398 0.61
399 0.58
400 0.51
401 0.47
402 0.43
403 0.36
404 0.32
405 0.33
406 0.29
407 0.29
408 0.3
409 0.3