Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LZH5

Protein Details
Accession A0A0U1LZH5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
285-309EVGTLLSRRARRRNPKRPTTSVLEAHydrophilic
312-335ARVAEERASRRKRDPKPCYYELEEHydrophilic
NLS Segment(s)
PositionSequence
292-302RRARRRNPKRP
321-323RRK
Subcellular Location(s) plas 26
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATTAEPHPTFTPALKPPPGVTSNPENPPSLAYESKLTIAIAVPFITVAFAARAYVRIIIKRSWIFEDWIAFVAWAGTVAYCGIMGATMSNHGGQHAWDITAQQAKDAAYWFNVASIEYGVMICITKLAILWLYRRFFSPIRWSLFDILIVSLIVILIGFYGITSFVKIFECSPRAKIFDKSIPGTCVDVSRLLNTSGMFNTITDYLILLLPVHAVWKLQLTPIKKLYIVLIFTFGLCAPVFSTIGFIVRLRISGNPDTTWNQPEILLWGAAELTSGNLVVCAPEVGTLLSRRARRRNPKRPTTSVLEASAARVAEERASRRKRDPKPCYYELEEGNLYDARVSPVGSEARIYQPETGAVQVRHEITVMSESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.4
4 0.39
5 0.44
6 0.46
7 0.41
8 0.4
9 0.41
10 0.45
11 0.49
12 0.5
13 0.45
14 0.41
15 0.4
16 0.39
17 0.35
18 0.29
19 0.24
20 0.25
21 0.25
22 0.25
23 0.24
24 0.2
25 0.16
26 0.15
27 0.15
28 0.12
29 0.11
30 0.1
31 0.09
32 0.09
33 0.08
34 0.07
35 0.06
36 0.05
37 0.05
38 0.06
39 0.07
40 0.08
41 0.09
42 0.14
43 0.16
44 0.19
45 0.22
46 0.23
47 0.3
48 0.32
49 0.34
50 0.34
51 0.33
52 0.32
53 0.31
54 0.32
55 0.26
56 0.24
57 0.21
58 0.16
59 0.14
60 0.12
61 0.09
62 0.07
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.11
83 0.1
84 0.1
85 0.09
86 0.1
87 0.12
88 0.16
89 0.16
90 0.13
91 0.14
92 0.14
93 0.15
94 0.16
95 0.14
96 0.1
97 0.12
98 0.11
99 0.11
100 0.11
101 0.1
102 0.09
103 0.08
104 0.07
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.04
116 0.06
117 0.07
118 0.11
119 0.17
120 0.18
121 0.19
122 0.2
123 0.23
124 0.22
125 0.26
126 0.32
127 0.33
128 0.36
129 0.38
130 0.38
131 0.37
132 0.36
133 0.32
134 0.23
135 0.16
136 0.11
137 0.09
138 0.07
139 0.05
140 0.04
141 0.03
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.03
150 0.03
151 0.03
152 0.04
153 0.05
154 0.06
155 0.07
156 0.08
157 0.11
158 0.14
159 0.15
160 0.18
161 0.19
162 0.22
163 0.23
164 0.25
165 0.26
166 0.28
167 0.3
168 0.3
169 0.29
170 0.27
171 0.26
172 0.24
173 0.19
174 0.15
175 0.12
176 0.12
177 0.11
178 0.11
179 0.11
180 0.11
181 0.11
182 0.11
183 0.11
184 0.09
185 0.1
186 0.09
187 0.08
188 0.08
189 0.08
190 0.08
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.05
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.06
205 0.06
206 0.09
207 0.13
208 0.15
209 0.2
210 0.23
211 0.24
212 0.23
213 0.23
214 0.23
215 0.22
216 0.21
217 0.16
218 0.15
219 0.14
220 0.13
221 0.13
222 0.11
223 0.09
224 0.08
225 0.08
226 0.06
227 0.07
228 0.07
229 0.07
230 0.08
231 0.07
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.1
238 0.09
239 0.11
240 0.16
241 0.18
242 0.21
243 0.19
244 0.22
245 0.24
246 0.27
247 0.27
248 0.22
249 0.19
250 0.17
251 0.17
252 0.16
253 0.14
254 0.11
255 0.09
256 0.08
257 0.07
258 0.07
259 0.07
260 0.04
261 0.03
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.05
273 0.05
274 0.08
275 0.09
276 0.13
277 0.18
278 0.24
279 0.31
280 0.41
281 0.51
282 0.6
283 0.71
284 0.77
285 0.83
286 0.88
287 0.9
288 0.88
289 0.84
290 0.81
291 0.76
292 0.69
293 0.6
294 0.52
295 0.43
296 0.36
297 0.32
298 0.24
299 0.17
300 0.14
301 0.12
302 0.14
303 0.19
304 0.24
305 0.32
306 0.39
307 0.44
308 0.53
309 0.63
310 0.7
311 0.76
312 0.8
313 0.81
314 0.83
315 0.83
316 0.8
317 0.76
318 0.72
319 0.63
320 0.59
321 0.49
322 0.4
323 0.37
324 0.31
325 0.24
326 0.18
327 0.17
328 0.14
329 0.13
330 0.13
331 0.11
332 0.15
333 0.17
334 0.17
335 0.17
336 0.17
337 0.23
338 0.25
339 0.27
340 0.24
341 0.23
342 0.25
343 0.25
344 0.25
345 0.25
346 0.23
347 0.24
348 0.26
349 0.27
350 0.25
351 0.24
352 0.2
353 0.16