Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LLZ9

Protein Details
Accession A0A0U1LLZ9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-106AFHFWGTRKNRRKAKSWAIAHydrophilic
411-435DQRKYLEREKEKEQRKLLKKSSRRGBasic
NLS Segment(s)
PositionSequence
373-435IRRLRKLDEEEKAEERKLAAEKIKKDERERVLRGMSAEDQRKYLEREKEKEQRKLLKKSSRRG
Subcellular Location(s) cyto 13, cyto_nucl 10.5, nucl 6, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012879  CCDC47  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0032469  P:endoplasmic reticulum calcium ion homeostasis  
Pfam View protein in Pfam  
PF07946  CCDC47  
Amino Acid Sequences MAEVFKNMFGGAGPSGAAHGDDDFADFAGAPDPSPVPLTASGSAPEASITGGTAVPFTKWYRVWERTSPSDFWQEAFVVPFLIFILAFHFWGTRKNRRKAKSWAIAHSPVLQSEFAVVGFSGIAHGTSTEGVESELVDPEKLLKEKTAQEFQSYATGRQNVAFLDVSIKLIKRYNPIVFIMDTVLGLFFESFPPPVERVESTLYTFDGKEKDLVPAPAGDVSSIKAPNSTYDGFIWAVVHKNCMRRLRVDRYDASITFTKENAKLPSWATVMTESAEITDLLLTPALIQAIEQAGDALEYLIISDQPVDRPVKLEETTPKKRVQLSLRLPSGSHEDTLPLYRYFLRLPDTLVSSAHFRPEVARKLRNTREEEIRRLRKLDEEEKAEERKLAAEKIKKDERERVLRGMSAEDQRKYLEREKEKEQRKLLKKSSRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.07
6 0.07
7 0.07
8 0.07
9 0.09
10 0.09
11 0.08
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.08
18 0.1
19 0.1
20 0.11
21 0.13
22 0.13
23 0.13
24 0.15
25 0.19
26 0.18
27 0.19
28 0.19
29 0.19
30 0.19
31 0.16
32 0.14
33 0.11
34 0.09
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.12
44 0.14
45 0.18
46 0.19
47 0.26
48 0.34
49 0.4
50 0.46
51 0.5
52 0.55
53 0.58
54 0.61
55 0.57
56 0.52
57 0.54
58 0.48
59 0.41
60 0.36
61 0.29
62 0.24
63 0.23
64 0.19
65 0.12
66 0.12
67 0.11
68 0.08
69 0.08
70 0.07
71 0.05
72 0.08
73 0.08
74 0.08
75 0.08
76 0.1
77 0.1
78 0.18
79 0.26
80 0.34
81 0.44
82 0.53
83 0.63
84 0.66
85 0.74
86 0.77
87 0.8
88 0.79
89 0.76
90 0.74
91 0.71
92 0.7
93 0.63
94 0.57
95 0.47
96 0.38
97 0.32
98 0.25
99 0.18
100 0.15
101 0.14
102 0.08
103 0.08
104 0.07
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.08
123 0.08
124 0.08
125 0.08
126 0.1
127 0.13
128 0.13
129 0.13
130 0.12
131 0.17
132 0.23
133 0.29
134 0.34
135 0.31
136 0.32
137 0.33
138 0.32
139 0.35
140 0.3
141 0.26
142 0.23
143 0.24
144 0.22
145 0.22
146 0.22
147 0.15
148 0.16
149 0.14
150 0.1
151 0.11
152 0.11
153 0.11
154 0.12
155 0.12
156 0.12
157 0.14
158 0.16
159 0.18
160 0.23
161 0.24
162 0.25
163 0.26
164 0.26
165 0.23
166 0.22
167 0.18
168 0.13
169 0.11
170 0.08
171 0.07
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.07
180 0.08
181 0.09
182 0.1
183 0.11
184 0.11
185 0.13
186 0.16
187 0.15
188 0.15
189 0.14
190 0.14
191 0.14
192 0.13
193 0.13
194 0.11
195 0.11
196 0.11
197 0.11
198 0.13
199 0.13
200 0.14
201 0.12
202 0.11
203 0.11
204 0.1
205 0.09
206 0.08
207 0.06
208 0.06
209 0.09
210 0.09
211 0.08
212 0.08
213 0.08
214 0.09
215 0.13
216 0.13
217 0.12
218 0.12
219 0.14
220 0.13
221 0.13
222 0.13
223 0.09
224 0.13
225 0.12
226 0.15
227 0.16
228 0.2
229 0.26
230 0.31
231 0.32
232 0.35
233 0.43
234 0.49
235 0.52
236 0.54
237 0.5
238 0.49
239 0.51
240 0.44
241 0.4
242 0.33
243 0.29
244 0.25
245 0.24
246 0.22
247 0.2
248 0.23
249 0.22
250 0.21
251 0.21
252 0.21
253 0.24
254 0.21
255 0.2
256 0.17
257 0.15
258 0.14
259 0.13
260 0.12
261 0.08
262 0.07
263 0.08
264 0.07
265 0.06
266 0.05
267 0.05
268 0.05
269 0.05
270 0.04
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.04
277 0.05
278 0.05
279 0.05
280 0.05
281 0.04
282 0.04
283 0.05
284 0.04
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.05
292 0.05
293 0.06
294 0.11
295 0.12
296 0.12
297 0.15
298 0.16
299 0.2
300 0.2
301 0.23
302 0.29
303 0.37
304 0.45
305 0.47
306 0.49
307 0.48
308 0.52
309 0.55
310 0.54
311 0.55
312 0.56
313 0.61
314 0.6
315 0.56
316 0.53
317 0.47
318 0.46
319 0.37
320 0.28
321 0.19
322 0.18
323 0.19
324 0.22
325 0.22
326 0.16
327 0.16
328 0.17
329 0.18
330 0.18
331 0.19
332 0.21
333 0.18
334 0.21
335 0.22
336 0.24
337 0.23
338 0.23
339 0.21
340 0.21
341 0.21
342 0.21
343 0.19
344 0.16
345 0.2
346 0.28
347 0.36
348 0.39
349 0.45
350 0.49
351 0.59
352 0.67
353 0.7
354 0.69
355 0.66
356 0.7
357 0.7
358 0.73
359 0.74
360 0.75
361 0.7
362 0.66
363 0.61
364 0.57
365 0.58
366 0.57
367 0.54
368 0.52
369 0.53
370 0.56
371 0.58
372 0.52
373 0.45
374 0.36
375 0.33
376 0.31
377 0.32
378 0.34
379 0.38
380 0.44
381 0.52
382 0.6
383 0.62
384 0.65
385 0.69
386 0.7
387 0.72
388 0.71
389 0.69
390 0.63
391 0.59
392 0.54
393 0.49
394 0.45
395 0.43
396 0.45
397 0.4
398 0.38
399 0.38
400 0.41
401 0.43
402 0.46
403 0.47
404 0.5
405 0.54
406 0.63
407 0.7
408 0.75
409 0.78
410 0.8
411 0.8
412 0.81
413 0.86
414 0.86
415 0.87