Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1MBL2

Protein Details
Accession A0A0U1MBL2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-37VPTEPRYRVHRPPPLRRSPRLBasic
NLS Segment(s)
Subcellular Location(s) mito 23, pero 2
Family & Domain DBs
Amino Acid Sequences MQTRLQSLKLSPAVATVPTEPRYRVHRPPPLRRSPRLAAPDIQITEAVDPLPMSSDVPPVPRGVAGSQSKIVGKRTTDRGDEYCVVVWVAAGELKHLSQEIAQYETAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.17
4 0.19
5 0.21
6 0.23
7 0.23
8 0.25
9 0.32
10 0.37
11 0.43
12 0.47
13 0.54
14 0.62
15 0.72
16 0.78
17 0.82
18 0.83
19 0.79
20 0.77
21 0.71
22 0.69
23 0.64
24 0.57
25 0.48
26 0.42
27 0.42
28 0.34
29 0.31
30 0.22
31 0.17
32 0.14
33 0.12
34 0.1
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.07
43 0.08
44 0.1
45 0.1
46 0.09
47 0.1
48 0.09
49 0.1
50 0.08
51 0.15
52 0.15
53 0.17
54 0.17
55 0.18
56 0.2
57 0.21
58 0.24
59 0.2
60 0.2
61 0.24
62 0.31
63 0.34
64 0.35
65 0.37
66 0.36
67 0.39
68 0.38
69 0.34
70 0.27
71 0.23
72 0.21
73 0.16
74 0.14
75 0.08
76 0.07
77 0.07
78 0.06
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.13
87 0.14
88 0.16