Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q4WKA9

Protein Details
Accession Q4WKA9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KSKNASQHHRSQKAHRNGIKHydrophilic
NLS Segment(s)
PositionSequence
11-63HRSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMKALKERKEGKRE
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG afm:AFUA_1G03110  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNASQHHRSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRHALHGTMKALKERKEGKREVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.82
4 0.77
5 0.74
6 0.73
7 0.8
8 0.78
9 0.73
10 0.72
11 0.72
12 0.74
13 0.74
14 0.75
15 0.73
16 0.71
17 0.73
18 0.71
19 0.65
20 0.61
21 0.59
22 0.59
23 0.54
24 0.56
25 0.57
26 0.59
27 0.62
28 0.63
29 0.69
30 0.63
31 0.68
32 0.63
33 0.63
34 0.62
35 0.57
36 0.54
37 0.48
38 0.46
39 0.43
40 0.45
41 0.4
42 0.42
43 0.48
44 0.55
45 0.6