FuNGI

A0A0U1LPB5

Protein Details

Accession

A0A0U1LPB5

Localization Confidence

Low

Confidence Score

7.7

NoLS Segment(s)

Position	Sequence	Protein Nature
355-376	PHTPTQQQTPPRQRTPTRKSNS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 15, cyto_nucl 15, nucl 11

Family & Domain DBs

InterPro	View protein in InterPro IPR000308 14-3-3 IPR036815 14-3-3_dom_sf

Amino Acid Sequences

MGSDYVAEMDMDWEEDGDVSDIADLGGSLQDLDISLYAIWMASHEVDQKYLGLLAGATSLENPFLSSMLYKILGLSVILSKKLLRARKLRRLDPTRETKSLQLYHHIIWLSREGLVVVEQYILPMVQDYIELKVLAYKLRASFYHIFVLFHNQPAIHTPGISSLPSSSNLQNGNGIAPTSSSSEVNRASISATPPPIEGGPVKKASNGGPPGLPSVPKPKLTASFLLPALDYTMTATPCFVQAATISDTLLPGSHPLRLSVKLEYAAYLYDCLHDADSCRRLAKQAIADVYNAQEGMDDESFEDAAELVAVLGRMVKRGGKTSSAGGSSTAGRDRSRSNDGQSIISKGTPPRQAPHTPTQQQTPPRQRTPTRKSNSPASTKAKPSPAPSHFKTKTTPKQSPSTVSGGSTTPKEPVPIINPI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.07
3	0.08
4	0.08
5	0.07
6	0.06
7	0.07
8	0.06
9	0.06
10	0.06
11	0.05
12	0.04
13	0.05
14	0.05
15	0.05
16	0.04
17	0.05
18	0.05
19	0.06
20	0.05
21	0.06
22	0.06
23	0.06
24	0.06
25	0.06
26	0.05
27	0.05
28	0.07
29	0.07
30	0.09
31	0.15
32	0.15
33	0.16
34	0.17
35	0.17
36	0.16
37	0.15
38	0.13
39	0.08
40	0.07
41	0.07
42	0.07
43	0.07
44	0.06
45	0.06
46	0.07
47	0.07
48	0.07
49	0.07
50	0.07
51	0.07
52	0.08
53	0.07
54	0.08
55	0.09
56	0.1
57	0.09
58	0.09
59	0.1
60	0.09
61	0.08
62	0.09
63	0.11
64	0.12
65	0.13
66	0.13
67	0.13
68	0.18
69	0.25
70	0.31
71	0.34
72	0.43
73	0.53
74	0.63
75	0.71
76	0.73
77	0.78
78	0.79
79	0.8
80	0.78
81	0.79
82	0.75
83	0.7
84	0.65
85	0.59
86	0.58
87	0.56
88	0.48
89	0.44
90	0.41
91	0.37
92	0.39
93	0.35
94	0.28
95	0.24
96	0.25
97	0.19
98	0.16
99	0.15
100	0.11
101	0.1
102	0.1
103	0.09
104	0.07
105	0.07
106	0.06
107	0.06
108	0.06
109	0.05
110	0.05
111	0.05
112	0.04
113	0.04
114	0.05
115	0.06
116	0.07
117	0.08
118	0.08
119	0.08
120	0.1
121	0.11
122	0.11
123	0.12
124	0.13
125	0.14
126	0.16
127	0.16
128	0.21
129	0.24
130	0.25
131	0.3
132	0.27
133	0.27
134	0.25
135	0.33
136	0.26
137	0.24
138	0.22
139	0.16
140	0.16
141	0.18
142	0.21
143	0.13
144	0.12
145	0.11
146	0.13
147	0.14
148	0.14
149	0.11
150	0.09
151	0.11
152	0.12
153	0.15
154	0.13
155	0.16
156	0.17
157	0.17
158	0.16
159	0.15
160	0.14
161	0.12
162	0.11
163	0.07
164	0.07
165	0.07
166	0.08
167	0.09
168	0.09
169	0.09
170	0.12
171	0.13
172	0.13
173	0.12
174	0.1
175	0.1
176	0.12
177	0.13
178	0.13
179	0.13
180	0.13
181	0.13
182	0.13
183	0.12
184	0.11
185	0.11
186	0.11
187	0.14
188	0.16
189	0.17
190	0.17
191	0.18
192	0.18
193	0.23
194	0.22
195	0.2
196	0.17
197	0.18
198	0.19
199	0.18
200	0.17
201	0.12
202	0.18
203	0.21
204	0.22
205	0.23
206	0.23
207	0.26
208	0.28
209	0.29
210	0.23
211	0.23
212	0.22
213	0.21
214	0.19
215	0.15
216	0.14
217	0.11
218	0.09
219	0.06
220	0.08
221	0.08
222	0.08
223	0.08
224	0.07
225	0.08
226	0.08
227	0.06
228	0.05
229	0.05
230	0.08
231	0.1
232	0.1
233	0.1
234	0.1
235	0.1
236	0.09
237	0.09
238	0.06
239	0.06
240	0.07
241	0.09
242	0.09
243	0.11
244	0.14
245	0.16
246	0.18
247	0.17
248	0.18
249	0.16
250	0.16
251	0.15
252	0.13
253	0.11
254	0.1
255	0.09
256	0.08
257	0.07
258	0.08
259	0.08
260	0.08
261	0.08
262	0.1
263	0.15
264	0.17
265	0.18
266	0.19
267	0.19
268	0.2
269	0.23
270	0.26
271	0.24
272	0.25
273	0.27
274	0.27
275	0.27
276	0.26
277	0.24
278	0.19
279	0.15
280	0.1
281	0.07
282	0.07
283	0.1
284	0.1
285	0.09
286	0.09
287	0.09
288	0.1
289	0.09
290	0.08
291	0.05
292	0.04
293	0.04
294	0.04
295	0.03
296	0.03
297	0.03
298	0.03
299	0.06
300	0.06
301	0.07
302	0.08
303	0.11
304	0.13
305	0.18
306	0.2
307	0.21
308	0.23
309	0.26
310	0.28
311	0.27
312	0.26
313	0.22
314	0.21
315	0.19
316	0.19
317	0.19
318	0.18
319	0.17
320	0.2
321	0.23
322	0.27
323	0.33
324	0.34
325	0.36
326	0.4
327	0.41
328	0.43
329	0.41
330	0.38
331	0.32
332	0.29
333	0.28
334	0.25
335	0.31
336	0.34
337	0.35
338	0.36
339	0.42
340	0.49
341	0.53
342	0.58
343	0.62
344	0.61
345	0.62
346	0.63
347	0.64
348	0.65
349	0.68
350	0.7
351	0.69
352	0.69
353	0.75
354	0.77
355	0.81
356	0.83
357	0.83
358	0.8
359	0.79
360	0.77
361	0.79
362	0.78
363	0.75
364	0.74
365	0.71
366	0.71
367	0.69
368	0.7
369	0.68
370	0.64
371	0.64
372	0.65
373	0.65
374	0.66
375	0.64
376	0.68
377	0.64
378	0.63
379	0.63
380	0.64
381	0.67
382	0.68
383	0.72
384	0.67
385	0.72
386	0.74
387	0.73
388	0.67
389	0.62
390	0.54
391	0.46
392	0.42
393	0.35
394	0.33
395	0.3
396	0.26
397	0.23
398	0.22
399	0.23
400	0.23
401	0.27

A0A0U1LPB5

3D AlphaFold-predicted Structure Viewer