Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1M9A3

Protein Details
Accession A0A0U1M9A3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-133AASKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKTKDBasic
NLS Segment(s)
PositionSequence
99-133SKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKTKD
Subcellular Location(s) mito 14.5, cyto_mito 10, nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFIRNPLLARKQMVLDVLHPNRANVKKDELREKLADLYKANKDQVSVFGFRTQYGGGKSTGFALIYDSHEALKKFEPHYRLVRIGAASKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKTKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.35
20 0.39
21 0.39
22 0.32
23 0.39
24 0.39
25 0.45
26 0.53
27 0.49
28 0.49
29 0.46
30 0.44
31 0.42
32 0.39
33 0.36
34 0.28
35 0.29
36 0.29
37 0.3
38 0.3
39 0.24
40 0.22
41 0.21
42 0.24
43 0.22
44 0.19
45 0.17
46 0.19
47 0.19
48 0.18
49 0.18
50 0.14
51 0.13
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.12
68 0.13
69 0.13
70 0.16
71 0.18
72 0.2
73 0.24
74 0.27
75 0.29
76 0.35
77 0.38
78 0.37
79 0.33
80 0.33
81 0.3
82 0.3
83 0.26
84 0.24
85 0.2
86 0.19
87 0.21
88 0.2
89 0.21
90 0.26
91 0.35
92 0.42
93 0.51
94 0.6
95 0.68
96 0.79
97 0.87
98 0.91
99 0.92
100 0.93
101 0.94
102 0.95
103 0.95
104 0.94
105 0.94
106 0.92
107 0.91
108 0.88
109 0.87
110 0.87
111 0.87
112 0.84
113 0.85