Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WE79

Protein Details
Accession Q4WE79    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
252-272AVNFATQKSWQKKEREEKAKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, mito 9, extr 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001977  Depp_CoAkinase  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0004140  F:dephospho-CoA kinase activity  
GO:0015937  P:coenzyme A biosynthetic process  
GO:0016310  P:phosphorylation  
KEGG afm:AFUA_5G02060  -  
Pfam View protein in Pfam  
PF01121  CoaE  
PROSITE View protein in PROSITE  
PS51219  DPCK  
CDD cd02022  DPCK  
Amino Acid Sequences MLIIGLTGSIATGKSTVSALLASPPYSLPIIDADLLARQVVEPGTPAYKAIVNYFGPSTPDLLLPPSDGDATSSQPPLNRPALGRRVFGTSEERKRDRMILNKIVHPAVRWEIYKALIYYYVRGHWAVVLDVPLLFESGMDLICGTVVVVGVRDPAVQMARLRSRDPHLSAEDAENRVRSQGDVRGKVEKAEFRGTGSARGVIVWNDGDKADLEKEVSKAMEMIKASSPNWWAWVLLLAPPLGVGIAAWNLAVNFATQKSWQKKEREEKAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.08
6 0.08
7 0.12
8 0.14
9 0.13
10 0.14
11 0.14
12 0.15
13 0.15
14 0.14
15 0.11
16 0.11
17 0.12
18 0.12
19 0.12
20 0.1
21 0.11
22 0.12
23 0.1
24 0.09
25 0.07
26 0.08
27 0.08
28 0.07
29 0.07
30 0.09
31 0.11
32 0.11
33 0.12
34 0.12
35 0.14
36 0.15
37 0.15
38 0.18
39 0.17
40 0.19
41 0.2
42 0.19
43 0.18
44 0.17
45 0.18
46 0.14
47 0.14
48 0.12
49 0.13
50 0.13
51 0.12
52 0.12
53 0.11
54 0.1
55 0.09
56 0.11
57 0.11
58 0.13
59 0.15
60 0.15
61 0.15
62 0.17
63 0.19
64 0.22
65 0.23
66 0.22
67 0.22
68 0.28
69 0.36
70 0.37
71 0.37
72 0.33
73 0.33
74 0.32
75 0.33
76 0.33
77 0.32
78 0.38
79 0.44
80 0.45
81 0.43
82 0.44
83 0.48
84 0.46
85 0.47
86 0.46
87 0.48
88 0.49
89 0.51
90 0.51
91 0.46
92 0.41
93 0.32
94 0.27
95 0.2
96 0.19
97 0.17
98 0.16
99 0.16
100 0.17
101 0.18
102 0.15
103 0.12
104 0.13
105 0.13
106 0.13
107 0.13
108 0.13
109 0.12
110 0.12
111 0.12
112 0.09
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.02
133 0.02
134 0.02
135 0.02
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.06
145 0.08
146 0.12
147 0.17
148 0.18
149 0.19
150 0.21
151 0.25
152 0.29
153 0.31
154 0.31
155 0.28
156 0.28
157 0.28
158 0.29
159 0.29
160 0.25
161 0.23
162 0.2
163 0.18
164 0.17
165 0.17
166 0.14
167 0.13
168 0.18
169 0.25
170 0.28
171 0.3
172 0.35
173 0.35
174 0.36
175 0.37
176 0.33
177 0.3
178 0.31
179 0.29
180 0.25
181 0.3
182 0.28
183 0.28
184 0.26
185 0.23
186 0.18
187 0.18
188 0.17
189 0.13
190 0.14
191 0.11
192 0.1
193 0.1
194 0.1
195 0.1
196 0.09
197 0.11
198 0.1
199 0.1
200 0.11
201 0.12
202 0.13
203 0.15
204 0.15
205 0.13
206 0.13
207 0.14
208 0.16
209 0.14
210 0.16
211 0.17
212 0.2
213 0.2
214 0.22
215 0.23
216 0.2
217 0.22
218 0.2
219 0.17
220 0.14
221 0.17
222 0.14
223 0.14
224 0.14
225 0.12
226 0.11
227 0.11
228 0.1
229 0.07
230 0.06
231 0.04
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.07
240 0.06
241 0.08
242 0.09
243 0.11
244 0.15
245 0.25
246 0.33
247 0.42
248 0.49
249 0.56
250 0.65
251 0.74
252 0.81