FuNGI

Q4WHF4

Protein Details

Accession

Q4WHF4

Localization Confidence

Low

Confidence Score

8.3

NoLS Segment(s)

Position	Sequence	Protein Nature
128-147	QETQLKRKRDETRSRNSPCE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 11, cyto 11, cyto_nucl 11

Family & Domain DBs

InterPro	View protein in InterPro IPR002052 DNA_methylase_N6_adenine_CS IPR007757 MT-A70-like
Gene Ontology	GO:0005634 C:nucleus GO:0036396 C:RNA N6-methyladenosine methyltransferase complex GO:0008168 F:methyltransferase activity GO:0003676 F:nucleic acid binding GO:0080009 P:mRNA methylation
KEGG	afm:AFUA_2G05600 -
Pfam	View protein in Pfam PF05063 MT-A70
PROSITE	View protein in PROSITE PS51143 MT_A70 PS00092 N6_MTASE

Amino Acid Sequences

MMPHSILYQNAEKTILLIDIPTSIACAQELSPVQLGATLCNSHPTEAGIDYHRKRHLLSSSPLEKPYAVSTEPKSDAARARVLSRLPVSERAYQTEIIEPLVRGALQEISRAHLDSAEWCLERKVLEQETQLKRKRDETRSRNSPCEDGCSADDALGVSAPNSPSIILSPGLNMFESLPEICNVLVRNTSLAQAVLDVRCKAEHEPEHREQTTTHRHVFFVPPFSTFLLCELPLSAEDEASQGPIPGLSLDRKFNLILLDPPWSNRSARRSGHYQTQSYSDIGLLSKRIRDILKAHLSDDSQCVSIAAIWITNAAKARRAAYDAIKGAGLSVYEEWMWIKTTTKGEPITPLDGLWRKPYEILVIGRRINRWPSDAADAITRRVIAGVPDVHSRKPNLKEVFEQVFFSRTGSGAKTGHTCMAYSALEVFARNLTAGWWACGNETLKFNSEDWWVEA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.18
3	0.12
4	0.1
5	0.09
6	0.09
7	0.1
8	0.09
9	0.09
10	0.09
11	0.09
12	0.09
13	0.1
14	0.09
15	0.15
16	0.16
17	0.18
18	0.18
19	0.18
20	0.18
21	0.2
22	0.19
23	0.15
24	0.17
25	0.15
26	0.14
27	0.21
28	0.22
29	0.19
30	0.2
31	0.2
32	0.19
33	0.19
34	0.22
35	0.21
36	0.29
37	0.32
38	0.38
39	0.41
40	0.4
41	0.4
42	0.44
43	0.47
44	0.45
45	0.48
46	0.51
47	0.54
48	0.57
49	0.56
50	0.5
51	0.43
52	0.37
53	0.34
54	0.28
55	0.23
56	0.24
57	0.26
58	0.32
59	0.34
60	0.34
61	0.32
62	0.33
63	0.37
64	0.35
65	0.38
66	0.32
67	0.32
68	0.33
69	0.33
70	0.34
71	0.3
72	0.31
73	0.28
74	0.34
75	0.36
76	0.39
77	0.4
78	0.4
79	0.4
80	0.37
81	0.35
82	0.32
83	0.28
84	0.22
85	0.22
86	0.17
87	0.15
88	0.14
89	0.13
90	0.09
91	0.09
92	0.12
93	0.11
94	0.14
95	0.14
96	0.16
97	0.17
98	0.18
99	0.17
100	0.13
101	0.13
102	0.12
103	0.15
104	0.16
105	0.15
106	0.15
107	0.15
108	0.16
109	0.16
110	0.17
111	0.19
112	0.19
113	0.21
114	0.25
115	0.35
116	0.42
117	0.51
118	0.55
119	0.54
120	0.53
121	0.6
122	0.65
123	0.66
124	0.68
125	0.68
126	0.72
127	0.78
128	0.81
129	0.78
130	0.71
131	0.64
132	0.54
133	0.51
134	0.41
135	0.33
136	0.29
137	0.25
138	0.23
139	0.19
140	0.18
141	0.12
142	0.11
143	0.08
144	0.07
145	0.05
146	0.07
147	0.07
148	0.07
149	0.07
150	0.07
151	0.07
152	0.07
153	0.09
154	0.07
155	0.07
156	0.08
157	0.08
158	0.09
159	0.09
160	0.08
161	0.07
162	0.07
163	0.08
164	0.07
165	0.07
166	0.07
167	0.07
168	0.07
169	0.08
170	0.08
171	0.08
172	0.09
173	0.09
174	0.1
175	0.1
176	0.11
177	0.1
178	0.09
179	0.08
180	0.08
181	0.1
182	0.09
183	0.1
184	0.1
185	0.1
186	0.1
187	0.11
188	0.11
189	0.16
190	0.21
191	0.25
192	0.33
193	0.37
194	0.43
195	0.42
196	0.42
197	0.36
198	0.38
199	0.42
200	0.39
201	0.39
202	0.33
203	0.33
204	0.34
205	0.38
206	0.33
207	0.28
208	0.24
209	0.21
210	0.22
211	0.22
212	0.2
213	0.15
214	0.15
215	0.1
216	0.1
217	0.09
218	0.08
219	0.07
220	0.07
221	0.09
222	0.07
223	0.06
224	0.06
225	0.07
226	0.06
227	0.07
228	0.06
229	0.05
230	0.05
231	0.04
232	0.04
233	0.04
234	0.06
235	0.07
236	0.1
237	0.11
238	0.12
239	0.13
240	0.13
241	0.14
242	0.13
243	0.11
244	0.11
245	0.11
246	0.14
247	0.13
248	0.14
249	0.14
250	0.15
251	0.15
252	0.18
253	0.23
254	0.27
255	0.29
256	0.33
257	0.37
258	0.39
259	0.48
260	0.49
261	0.44
262	0.38
263	0.4
264	0.37
265	0.31
266	0.28
267	0.19
268	0.14
269	0.13
270	0.12
271	0.11
272	0.1
273	0.11
274	0.11
275	0.15
276	0.14
277	0.17
278	0.19
279	0.26
280	0.33
281	0.32
282	0.33
283	0.32
284	0.32
285	0.3
286	0.29
287	0.21
288	0.14
289	0.13
290	0.12
291	0.1
292	0.09
293	0.09
294	0.07
295	0.05
296	0.05
297	0.07
298	0.07
299	0.08
300	0.12
301	0.12
302	0.15
303	0.17
304	0.19
305	0.19
306	0.21
307	0.22
308	0.23
309	0.28
310	0.26
311	0.25
312	0.23
313	0.21
314	0.19
315	0.16
316	0.12
317	0.07
318	0.07
319	0.07
320	0.07
321	0.07
322	0.07
323	0.08
324	0.1
325	0.09
326	0.11
327	0.14
328	0.18
329	0.2
330	0.25
331	0.26
332	0.25
333	0.3
334	0.32
335	0.3
336	0.27
337	0.25
338	0.26
339	0.29
340	0.29
341	0.29
342	0.28
343	0.25
344	0.26
345	0.27
346	0.23
347	0.24
348	0.28
349	0.28
350	0.32
351	0.35
352	0.37
353	0.38
354	0.39
355	0.4
356	0.37
357	0.35
358	0.32
359	0.31
360	0.34
361	0.33
362	0.3
363	0.31
364	0.3
365	0.28
366	0.26
367	0.23
368	0.18
369	0.17
370	0.16
371	0.1
372	0.14
373	0.16
374	0.17
375	0.25
376	0.27
377	0.29
378	0.33
379	0.35
380	0.38
381	0.42
382	0.49
383	0.47
384	0.49
385	0.52
386	0.55
387	0.59
388	0.52
389	0.48
390	0.4
391	0.36
392	0.31
393	0.27
394	0.21
395	0.15
396	0.16
397	0.15
398	0.19
399	0.18
400	0.21
401	0.24
402	0.25
403	0.28
404	0.26
405	0.25
406	0.21
407	0.24
408	0.22
409	0.18
410	0.17
411	0.15
412	0.15
413	0.15
414	0.15
415	0.12
416	0.12
417	0.11
418	0.1
419	0.09
420	0.15
421	0.15
422	0.15
423	0.16
424	0.16
425	0.17
426	0.22
427	0.24
428	0.21
429	0.24
430	0.26
431	0.27
432	0.3
433	0.29
434	0.27
435	0.29

Q4WHF4

3D AlphaFold-predicted Structure Viewer