Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WE45

Protein Details
Accession Q4WE45    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-51STKICTRRMTRTRAWKRPRRRSSHQKRNVSRWNPHydrophilic
NLS Segment(s)
PositionSequence
28-45RTRAWKRPRRRSSHQKRN
Subcellular Location(s) mito 21, nucl 3, plas 2, cyto_nucl 2
Family & Domain DBs
KEGG afm:AFUA_5G01720  -  
Amino Acid Sequences MRIHPVPVPLRILIHVPSTKICTRRMTRTRAWKRPRRRSSHQKRNVSRWNPPAQRIPQSRILGPPSGQFGLLDVGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.21
5 0.25
6 0.29
7 0.3
8 0.32
9 0.34
10 0.38
11 0.48
12 0.53
13 0.55
14 0.58
15 0.67
16 0.73
17 0.75
18 0.81
19 0.8
20 0.84
21 0.88
22 0.9
23 0.87
24 0.87
25 0.88
26 0.89
27 0.9
28 0.89
29 0.88
30 0.85
31 0.85
32 0.86
33 0.79
34 0.76
35 0.73
36 0.73
37 0.67
38 0.65
39 0.64
40 0.59
41 0.63
42 0.6
43 0.56
44 0.55
45 0.54
46 0.52
47 0.48
48 0.46
49 0.4
50 0.36
51 0.33
52 0.29
53 0.27
54 0.25
55 0.2
56 0.18
57 0.17