Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0U1LPU8

Protein Details
Accession A0A0U1LPU8    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-34GPTGRNKKGRGHVKPIRCSNCHydrophilic
89-124GKIVRVRSRDGRRNRAPPPRIRYNKDGKKLNPQQAAHydrophilic
NLS Segment(s)
PositionSequence
93-117RVRSRDGRRNRAPPPRIRYNKDGKK
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MFRMHPHQISDGTGPTGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSRDGRRNRAPPPRIRYNKDGKKLNPQQAAKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.35
4 0.36
5 0.4
6 0.42
7 0.47
8 0.55
9 0.64
10 0.65
11 0.68
12 0.72
13 0.75
14 0.8
15 0.82
16 0.78
17 0.71
18 0.7
19 0.67
20 0.67
21 0.66
22 0.64
23 0.61
24 0.62
25 0.65
26 0.67
27 0.69
28 0.69
29 0.7
30 0.71
31 0.73
32 0.69
33 0.7
34 0.65
35 0.65
36 0.58
37 0.5
38 0.43
39 0.35
40 0.32
41 0.26
42 0.23
43 0.14
44 0.13
45 0.1
46 0.09
47 0.09
48 0.07
49 0.07
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.13
63 0.16
64 0.18
65 0.2
66 0.23
67 0.24
68 0.24
69 0.26
70 0.24
71 0.2
72 0.21
73 0.19
74 0.2
75 0.2
76 0.22
77 0.23
78 0.29
79 0.32
80 0.33
81 0.36
82 0.41
83 0.5
84 0.56
85 0.62
86 0.66
87 0.7
88 0.76
89 0.81
90 0.82
91 0.81
92 0.81
93 0.8
94 0.81
95 0.81
96 0.79
97 0.79
98 0.79
99 0.81
100 0.8
101 0.81
102 0.75
103 0.77
104 0.8
105 0.81
106 0.79
107 0.73