Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XU33

Protein Details
Accession A0A0S6XU33   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPAIRGSDSKKKTRRRVRDIDQVYADHydrophilic
64-90ANYDKHNKGKPHKKRVRQLKEEPYTQKBasic
NLS Segment(s)
PositionSequence
11-15KKTRR
70-80NKGKPHKKRVR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPAIRGSDSKKKTRRRVRDIDQVYADLRSERHLAIYKETKATEDLPGLGQWYCTECAKWFESEANYDKHNKGKPHKKRVRQLKEEPYTQKEAEAAAGLFTDNGKRLNTAMEEDTELLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.89
4 0.88
5 0.9
6 0.84
7 0.8
8 0.71
9 0.62
10 0.52
11 0.42
12 0.34
13 0.24
14 0.19
15 0.15
16 0.15
17 0.13
18 0.15
19 0.2
20 0.2
21 0.26
22 0.32
23 0.31
24 0.32
25 0.32
26 0.3
27 0.27
28 0.27
29 0.22
30 0.17
31 0.15
32 0.13
33 0.13
34 0.13
35 0.11
36 0.09
37 0.07
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.12
44 0.13
45 0.14
46 0.12
47 0.13
48 0.14
49 0.17
50 0.19
51 0.17
52 0.17
53 0.2
54 0.21
55 0.25
56 0.29
57 0.32
58 0.4
59 0.49
60 0.58
61 0.66
62 0.75
63 0.78
64 0.83
65 0.88
66 0.89
67 0.88
68 0.87
69 0.86
70 0.83
71 0.81
72 0.77
73 0.71
74 0.66
75 0.56
76 0.47
77 0.36
78 0.3
79 0.23
80 0.19
81 0.14
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.11
90 0.11
91 0.12
92 0.13
93 0.16
94 0.18
95 0.2
96 0.2
97 0.2
98 0.22
99 0.22