Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MF00

Protein Details
Accession A0A0C9MF00   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
51-76QNIKTLKSYLRKRKAKRPYLNINSRTHydrophilic
NLS Segment(s)
PositionSequence
61-67RKRKAKR
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR021109  Peptidase_aspartic_dom_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR000477  RT_dom  
Pfam View protein in Pfam  
PF00078  RVT_1  
Amino Acid Sequences MITEELRNVILTIRTHIERRTIDIVGMRYDVVLGMDWLQEHNLDKKRRYYQNIKTLKSYLRKRKAKRPYLNINSRTIRYLSKKKEEDFLKEYIELINDILREYLDDFVSAYLDDILIFSKTYDEHVGHVRKVLERLKEKALLVKLSKCEFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.27
4 0.33
5 0.3
6 0.35
7 0.36
8 0.31
9 0.3
10 0.32
11 0.31
12 0.26
13 0.25
14 0.19
15 0.14
16 0.14
17 0.12
18 0.08
19 0.07
20 0.05
21 0.05
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.09
28 0.16
29 0.23
30 0.28
31 0.31
32 0.39
33 0.48
34 0.55
35 0.61
36 0.64
37 0.66
38 0.71
39 0.77
40 0.71
41 0.65
42 0.61
43 0.59
44 0.58
45 0.58
46 0.59
47 0.6
48 0.68
49 0.7
50 0.77
51 0.81
52 0.83
53 0.83
54 0.81
55 0.81
56 0.82
57 0.85
58 0.78
59 0.74
60 0.65
61 0.57
62 0.49
63 0.39
64 0.34
65 0.31
66 0.37
67 0.37
68 0.43
69 0.46
70 0.46
71 0.53
72 0.51
73 0.51
74 0.45
75 0.41
76 0.34
77 0.3
78 0.29
79 0.22
80 0.2
81 0.13
82 0.1
83 0.09
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.07
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.07
108 0.09
109 0.13
110 0.12
111 0.15
112 0.23
113 0.27
114 0.27
115 0.3
116 0.3
117 0.29
118 0.35
119 0.38
120 0.39
121 0.42
122 0.45
123 0.48
124 0.5
125 0.48
126 0.49
127 0.48
128 0.46
129 0.45
130 0.46
131 0.47