Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XLG6

Protein Details
Accession A0A0S6XLG6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-48LLTDSQRDRSRSRRRSRSPRRSRREYDSRSRSRDBasic
NLS Segment(s)
PositionSequence
23-56RSRSRRRSRSPRRSRREYDSRSRSRDDYRRSERR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MELGEVKEIQIEISLLTDSQRDRSRSRRRSRSPRRSRREYDSRSRSRDDYRRSERRSRSPLNGNSGGGGYSNSYSSTRAPPPPRSHEDRSGAKDQMMSAVRENSQQDRRVYVGNLSYDVKWHHLKDFMRQGQDSTYPACRVGCGSDFHTAGEVLFADVLLLPNGMSKVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.1
5 0.11
6 0.17
7 0.24
8 0.27
9 0.32
10 0.43
11 0.53
12 0.61
13 0.71
14 0.76
15 0.8
16 0.87
17 0.94
18 0.94
19 0.95
20 0.95
21 0.94
22 0.93
23 0.9
24 0.88
25 0.87
26 0.85
27 0.84
28 0.84
29 0.82
30 0.78
31 0.75
32 0.69
33 0.67
34 0.68
35 0.65
36 0.64
37 0.66
38 0.7
39 0.73
40 0.78
41 0.77
42 0.78
43 0.79
44 0.74
45 0.72
46 0.72
47 0.7
48 0.68
49 0.62
50 0.52
51 0.44
52 0.38
53 0.3
54 0.2
55 0.15
56 0.08
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.1
63 0.14
64 0.17
65 0.23
66 0.28
67 0.34
68 0.4
69 0.46
70 0.5
71 0.53
72 0.54
73 0.54
74 0.55
75 0.53
76 0.52
77 0.49
78 0.44
79 0.37
80 0.33
81 0.26
82 0.25
83 0.22
84 0.17
85 0.14
86 0.16
87 0.16
88 0.18
89 0.2
90 0.21
91 0.24
92 0.28
93 0.28
94 0.28
95 0.29
96 0.28
97 0.27
98 0.24
99 0.22
100 0.18
101 0.19
102 0.19
103 0.17
104 0.17
105 0.18
106 0.19
107 0.2
108 0.2
109 0.21
110 0.26
111 0.27
112 0.33
113 0.43
114 0.43
115 0.44
116 0.43
117 0.42
118 0.39
119 0.4
120 0.33
121 0.26
122 0.25
123 0.21
124 0.22
125 0.21
126 0.18
127 0.17
128 0.19
129 0.18
130 0.18
131 0.2
132 0.24
133 0.24
134 0.24
135 0.24
136 0.2
137 0.17
138 0.15
139 0.12
140 0.07
141 0.07
142 0.06
143 0.05
144 0.06
145 0.07
146 0.06
147 0.06
148 0.05
149 0.07
150 0.08