Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WBV8

Protein Details
Accession Q4WBV8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPRDEDLKRVRENQRKCRQRKRDYIAELESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
KEGG afm:AFUA_8G06630  -  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MPRDEDLKRVRENQRKCRQRKRDYIAELESKIAAYAEAAAEADRRRQAVEENLCRENEALRTLLASSGFGHNVPNLNTAQKQQEAILDDIQMNLSFTSNTLPTTLELHADSLALELPNVTSSFGSPTTIREVADTGLVAPSSVDFTPSQSTDLSTCLDFPGPGLHELTVPEGESRTSPLELLPPTNQSTIGLNMPIGLVDPILQDTTLCAVAIQIVRHCNKKNLSMVELDAKLRHGYRNARSPLEGCRVTNWVLLSVLAEIVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.89
4 0.91
5 0.91
6 0.92
7 0.93
8 0.91
9 0.9
10 0.86
11 0.84
12 0.8
13 0.75
14 0.65
15 0.55
16 0.47
17 0.36
18 0.29
19 0.21
20 0.14
21 0.07
22 0.08
23 0.06
24 0.06
25 0.06
26 0.06
27 0.09
28 0.1
29 0.14
30 0.15
31 0.16
32 0.16
33 0.17
34 0.21
35 0.28
36 0.37
37 0.4
38 0.43
39 0.45
40 0.44
41 0.44
42 0.4
43 0.33
44 0.25
45 0.19
46 0.15
47 0.12
48 0.13
49 0.12
50 0.13
51 0.11
52 0.1
53 0.09
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.14
60 0.14
61 0.15
62 0.14
63 0.16
64 0.17
65 0.19
66 0.21
67 0.2
68 0.2
69 0.18
70 0.2
71 0.2
72 0.21
73 0.19
74 0.16
75 0.15
76 0.14
77 0.14
78 0.11
79 0.08
80 0.06
81 0.06
82 0.05
83 0.05
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.11
91 0.11
92 0.11
93 0.1
94 0.11
95 0.1
96 0.09
97 0.08
98 0.06
99 0.06
100 0.05
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.04
108 0.05
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.13
115 0.13
116 0.13
117 0.12
118 0.12
119 0.11
120 0.11
121 0.1
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.05
129 0.05
130 0.06
131 0.06
132 0.08
133 0.1
134 0.11
135 0.12
136 0.1
137 0.11
138 0.1
139 0.11
140 0.11
141 0.09
142 0.09
143 0.08
144 0.08
145 0.08
146 0.07
147 0.09
148 0.09
149 0.09
150 0.1
151 0.09
152 0.1
153 0.1
154 0.12
155 0.09
156 0.09
157 0.08
158 0.08
159 0.08
160 0.08
161 0.1
162 0.1
163 0.1
164 0.1
165 0.1
166 0.14
167 0.14
168 0.17
169 0.16
170 0.17
171 0.19
172 0.2
173 0.19
174 0.16
175 0.17
176 0.16
177 0.16
178 0.13
179 0.1
180 0.1
181 0.1
182 0.09
183 0.08
184 0.05
185 0.04
186 0.04
187 0.05
188 0.06
189 0.06
190 0.06
191 0.05
192 0.06
193 0.08
194 0.08
195 0.07
196 0.06
197 0.06
198 0.09
199 0.11
200 0.12
201 0.13
202 0.2
203 0.23
204 0.3
205 0.33
206 0.37
207 0.39
208 0.45
209 0.5
210 0.48
211 0.47
212 0.43
213 0.43
214 0.43
215 0.4
216 0.35
217 0.28
218 0.25
219 0.25
220 0.25
221 0.26
222 0.26
223 0.33
224 0.39
225 0.49
226 0.52
227 0.53
228 0.54
229 0.52
230 0.52
231 0.52
232 0.48
233 0.39
234 0.37
235 0.37
236 0.36
237 0.37
238 0.3
239 0.23
240 0.2
241 0.19
242 0.17
243 0.14