Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WF67

Protein Details
Accession Q4WF67    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-44TRPYRIAQFGRKKKNAQKLAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito_nucl 10.333, cyto 5.5, mito 4.5
Family & Domain DBs
KEGG afm:AFUA_3G03290  -  
Amino Acid Sequences MSSQSTDVSVKLTYLQWQSIYNDTRPYRIAQFGRKKKNAQKLAHNLIFHKGDSEELIRDIRKTKEQGAQFSLEMNGFIYREYPSSSMAPSDFWSAEQVEKVFLPECEAVIRNEIKGVDQVYIFDWKVTSPISCAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.23
5 0.25
6 0.3
7 0.33
8 0.29
9 0.35
10 0.34
11 0.35
12 0.34
13 0.35
14 0.31
15 0.35
16 0.38
17 0.4
18 0.5
19 0.57
20 0.66
21 0.7
22 0.75
23 0.76
24 0.81
25 0.8
26 0.75
27 0.76
28 0.75
29 0.78
30 0.73
31 0.66
32 0.56
33 0.51
34 0.46
35 0.35
36 0.27
37 0.18
38 0.14
39 0.14
40 0.14
41 0.1
42 0.1
43 0.12
44 0.11
45 0.12
46 0.15
47 0.16
48 0.19
49 0.21
50 0.24
51 0.28
52 0.3
53 0.33
54 0.32
55 0.32
56 0.27
57 0.25
58 0.22
59 0.15
60 0.13
61 0.1
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.09
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.14
78 0.12
79 0.11
80 0.13
81 0.12
82 0.13
83 0.13
84 0.12
85 0.11
86 0.11
87 0.12
88 0.11
89 0.1
90 0.13
91 0.12
92 0.12
93 0.14
94 0.15
95 0.14
96 0.18
97 0.19
98 0.15
99 0.17
100 0.17
101 0.15
102 0.17
103 0.17
104 0.14
105 0.13
106 0.14
107 0.14
108 0.18
109 0.17
110 0.15
111 0.14
112 0.13
113 0.15
114 0.16
115 0.14