A0A0S6XEA8

UniProt ID: A0A0S6XEA8   Organism: fungal sp. No.11243
Gene: ANO11243_041610   Protein: Uncharacterized protein
Length: 151 AA

Protein Details

• Accession: A0A0S6XEA8
• Localization Confidence: Medium
• Confidence Score: 10.1
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  103-126	AALVTEKQKKRQTHFPQRNYAIKA	Hydrophilic

• Subcellular Location(s): nucl 18.5, cyto_nucl 10.5, mito 7
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
  • CDD:
    • cd00427 Ribosomal_L29_HIP
• Amino Acid Sequences: MSSLGKVKASQLWGKNKEELKKQLEDLKAELVQLRTQKIAGGASSKLNKIHDVRKSIARVLTIININQRSQLRIFYKNKKYLPLDLRPKQTRAIRRRLTKHEAALVTEKQKKRQTHFPQRNYAIKA

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.54
2, 0.58
3, 0.59
4, 0.61
5, 0.62
6, 0.63
7, 0.58
8, 0.56
9, 0.56
10, 0.56
11, 0.54
12, 0.49
13, 0.42
14, 0.38
15, 0.32
16, 0.29
17, 0.28
18, 0.22
19, 0.21
20, 0.21
21, 0.21
22, 0.17
23, 0.17
24, 0.17
25, 0.16
26, 0.15
27, 0.13
28, 0.12
29, 0.12
30, 0.15
31, 0.18
32, 0.18
33, 0.19
34, 0.19
35, 0.22
36, 0.23
37, 0.29
38, 0.3
39, 0.33
40, 0.34
41, 0.38
42, 0.39
43, 0.37
44, 0.35
45, 0.28
46, 0.24
47, 0.2
48, 0.2
49, 0.15
50, 0.14
51, 0.16
52, 0.16
53, 0.15
54, 0.19
55, 0.18
56, 0.17
57, 0.17
58, 0.22
59, 0.22
60, 0.3
61, 0.37
62, 0.43
63, 0.51
64, 0.58
65, 0.59
66, 0.6
67, 0.59
68, 0.59
69, 0.59
70, 0.59
71, 0.6
72, 0.59
73, 0.67
74, 0.64
75, 0.63
76, 0.61
77, 0.61
78, 0.61
79, 0.6
80, 0.64
81, 0.63
82, 0.69
83, 0.76
84, 0.77
85, 0.78
86, 0.74
87, 0.7
88, 0.66
89, 0.59
90, 0.53
91, 0.5
92, 0.46
93, 0.46
94, 0.48
95, 0.47
96, 0.49
97, 0.55
98, 0.59
99, 0.61
100, 0.67
101, 0.71
102, 0.73
103, 0.81
104, 0.82
105, 0.84
106, 0.85