Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LZ98

Protein Details
Accession A0A0C9LZ98    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-76SKSSTEWQTVQKKPRKQKSKSDIARQHydrophilic
NLS Segment(s)
PositionSequence
63-69KPRKQKS
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPAVGSKYIVIDDDPEDELAMFDRSPEEDESSSLTKMTRSSTKSTGKTVSSKSSTEWQTVQKKPRKQKSKSDIARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.11
5 0.11
6 0.1
7 0.1
8 0.07
9 0.06
10 0.07
11 0.07
12 0.1
13 0.11
14 0.12
15 0.12
16 0.12
17 0.16
18 0.16
19 0.16
20 0.14
21 0.13
22 0.11
23 0.12
24 0.14
25 0.16
26 0.18
27 0.22
28 0.29
29 0.36
30 0.37
31 0.4
32 0.41
33 0.39
34 0.4
35 0.39
36 0.39
37 0.35
38 0.33
39 0.32
40 0.36
41 0.35
42 0.34
43 0.34
44 0.36
45 0.42
46 0.48
47 0.56
48 0.57
49 0.65
50 0.73
51 0.8
52 0.82
53 0.81
54 0.85
55 0.85
56 0.88