Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4X205

Protein Details
Accession Q4X205    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-34GVNVPKTRRTYCKSKECRKHTQHKVTQYKAGHydrophilic
76-95ECTACKTKKQLALKRCKHFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG afm:AFUA_2G08130  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences METGVNVPKTRRTYCKSKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKTKKQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.76
4 0.8
5 0.85
6 0.84
7 0.89
8 0.88
9 0.89
10 0.89
11 0.89
12 0.86
13 0.86
14 0.88
15 0.81
16 0.8
17 0.74
18 0.68
19 0.6
20 0.55
21 0.44
22 0.36
23 0.34
24 0.33
25 0.32
26 0.28
27 0.34
28 0.37
29 0.42
30 0.47
31 0.51
32 0.48
33 0.54
34 0.61
35 0.59
36 0.6
37 0.58
38 0.58
39 0.56
40 0.58
41 0.49
42 0.44
43 0.4
44 0.33
45 0.35
46 0.37
47 0.35
48 0.3
49 0.37
50 0.41
51 0.5
52 0.59
53 0.62
54 0.61
55 0.65
56 0.72
57 0.72
58 0.71
59 0.68
60 0.63
61 0.6
62 0.58
63 0.53
64 0.48
65 0.48
66 0.43
67 0.4
68 0.41
69 0.43
70 0.46
71 0.54
72 0.58
73 0.6
74 0.7
75 0.75
76 0.8
77 0.79
78 0.74
79 0.67
80 0.6
81 0.57
82 0.57
83 0.56
84 0.55
85 0.54
86 0.51
87 0.49
88 0.48
89 0.42