Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MBK0

Protein Details
Accession A0A0C9MBK0    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
177-212ATNGEKKKAGRPKKSESSTSLKQKKEPKKAATETGEHydrophilic
NLS Segment(s)
PositionSequence
100-129KKQEEKKEESKEEKKEDAKENGDAKAGDKR
181-221EKKKAGRPKKSESSTSLKQKKEPKKAATETGEPRRSSRNKA
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MADKEIKEGDKVSWQWSGSRPGGEVSEVKDKGEVSMTSHRGNEVKKNAEPGNPAVKVSRSGNDVVKKASELDVEKPGDKHAEASGEHKEVTEKDKENAEKKQEEKKEESKEEKKEDAKENGDAKAGDKRSKDEADKDEKEKENGEKEADEDNEEEEGDKEEDEPSTKKQKTDANGEATNGEKKKAGRPKKSESSTSLKQKKEPKKAATETGEPRRSSRNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.35
4 0.4
5 0.34
6 0.34
7 0.31
8 0.28
9 0.29
10 0.27
11 0.25
12 0.22
13 0.28
14 0.27
15 0.26
16 0.26
17 0.25
18 0.24
19 0.26
20 0.22
21 0.18
22 0.27
23 0.3
24 0.31
25 0.31
26 0.32
27 0.32
28 0.35
29 0.38
30 0.36
31 0.39
32 0.38
33 0.44
34 0.44
35 0.44
36 0.44
37 0.41
38 0.41
39 0.36
40 0.35
41 0.3
42 0.29
43 0.29
44 0.28
45 0.25
46 0.2
47 0.22
48 0.27
49 0.3
50 0.31
51 0.29
52 0.27
53 0.25
54 0.23
55 0.22
56 0.19
57 0.16
58 0.18
59 0.22
60 0.23
61 0.24
62 0.23
63 0.23
64 0.22
65 0.19
66 0.18
67 0.13
68 0.14
69 0.13
70 0.16
71 0.18
72 0.17
73 0.17
74 0.16
75 0.16
76 0.14
77 0.17
78 0.2
79 0.18
80 0.19
81 0.25
82 0.29
83 0.32
84 0.36
85 0.38
86 0.37
87 0.39
88 0.46
89 0.46
90 0.47
91 0.48
92 0.51
93 0.53
94 0.54
95 0.59
96 0.57
97 0.58
98 0.57
99 0.56
100 0.52
101 0.5
102 0.5
103 0.47
104 0.41
105 0.41
106 0.38
107 0.34
108 0.32
109 0.26
110 0.22
111 0.23
112 0.23
113 0.22
114 0.21
115 0.23
116 0.27
117 0.3
118 0.32
119 0.31
120 0.36
121 0.41
122 0.44
123 0.44
124 0.46
125 0.44
126 0.43
127 0.4
128 0.38
129 0.34
130 0.31
131 0.3
132 0.23
133 0.23
134 0.25
135 0.23
136 0.2
137 0.15
138 0.15
139 0.13
140 0.13
141 0.12
142 0.08
143 0.1
144 0.09
145 0.09
146 0.08
147 0.09
148 0.09
149 0.12
150 0.13
151 0.16
152 0.26
153 0.28
154 0.29
155 0.33
156 0.39
157 0.42
158 0.49
159 0.5
160 0.47
161 0.47
162 0.46
163 0.43
164 0.39
165 0.4
166 0.32
167 0.26
168 0.22
169 0.23
170 0.32
171 0.41
172 0.49
173 0.53
174 0.61
175 0.69
176 0.77
177 0.81
178 0.78
179 0.74
180 0.72
181 0.71
182 0.73
183 0.72
184 0.65
185 0.66
186 0.71
187 0.75
188 0.77
189 0.78
190 0.75
191 0.77
192 0.8
193 0.82
194 0.78
195 0.76
196 0.74
197 0.75
198 0.74
199 0.64
200 0.61
201 0.62