Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XJT4

Protein Details
Accession A0A0S6XJT4    Localization Confidence High Confidence Score 22.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-66GRYGDRQQRSRSPERTRKRQRRSPESRDRRHEQSIBasic
205-226LLDHRHRRREYRKLHKERLDELBasic
NLS Segment(s)
PositionSequence
41-61SRSPERTRKRQRRSPESRDRR
209-250RHRRREYRKLHKERLDELVPKAEPGTKERQLEKKREKAESSR
280-296KLKANEKRKTERELRKE
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MTNESCKTSEERRHYVPAKSSSSMIRDLSCVGRYGDRQQRSRSPERTRKRQRRSPESRDRRHEQSITLPFKARHISKHDLNKFRPLFSMYLDVQKQIFIEDLDEHELKGRWKSFMNKWNRAELSEGYYDPQTKARVDSRAAELEDTHQESKGNQNGNAMAKVDDEEHDDYGPALPRNHVKAAAQPNRQDLEYRDELEDDARQEALLDHRHRRREYRKLHKERLDELVPKAEPGTKERQLEKKREKAESSRAFREARSPGAEEVGEGELMGDEGFEGYKAKLKANEKRKTERELRKEELLRVRAAEREERLSQHRAKEEKTMEMLQAIARQRFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.67
4 0.65
5 0.62
6 0.57
7 0.54
8 0.49
9 0.48
10 0.45
11 0.39
12 0.32
13 0.27
14 0.28
15 0.29
16 0.25
17 0.23
18 0.21
19 0.23
20 0.25
21 0.33
22 0.4
23 0.44
24 0.49
25 0.55
26 0.61
27 0.66
28 0.73
29 0.73
30 0.75
31 0.77
32 0.82
33 0.86
34 0.89
35 0.91
36 0.92
37 0.91
38 0.91
39 0.92
40 0.92
41 0.92
42 0.92
43 0.92
44 0.91
45 0.91
46 0.87
47 0.82
48 0.79
49 0.71
50 0.62
51 0.61
52 0.61
53 0.57
54 0.53
55 0.5
56 0.42
57 0.43
58 0.48
59 0.4
60 0.37
61 0.39
62 0.44
63 0.48
64 0.58
65 0.63
66 0.65
67 0.66
68 0.69
69 0.64
70 0.58
71 0.52
72 0.44
73 0.36
74 0.29
75 0.32
76 0.23
77 0.28
78 0.27
79 0.26
80 0.23
81 0.23
82 0.2
83 0.15
84 0.15
85 0.08
86 0.09
87 0.08
88 0.1
89 0.14
90 0.14
91 0.13
92 0.15
93 0.16
94 0.16
95 0.2
96 0.2
97 0.18
98 0.21
99 0.28
100 0.34
101 0.42
102 0.5
103 0.55
104 0.56
105 0.62
106 0.59
107 0.53
108 0.48
109 0.4
110 0.34
111 0.27
112 0.25
113 0.18
114 0.18
115 0.19
116 0.16
117 0.18
118 0.15
119 0.14
120 0.18
121 0.2
122 0.22
123 0.23
124 0.25
125 0.25
126 0.27
127 0.26
128 0.23
129 0.19
130 0.18
131 0.19
132 0.19
133 0.16
134 0.13
135 0.13
136 0.14
137 0.19
138 0.21
139 0.21
140 0.18
141 0.19
142 0.22
143 0.23
144 0.23
145 0.18
146 0.13
147 0.11
148 0.11
149 0.1
150 0.08
151 0.1
152 0.11
153 0.1
154 0.1
155 0.1
156 0.09
157 0.1
158 0.12
159 0.1
160 0.09
161 0.11
162 0.13
163 0.16
164 0.17
165 0.17
166 0.15
167 0.21
168 0.31
169 0.37
170 0.39
171 0.38
172 0.41
173 0.41
174 0.41
175 0.35
176 0.27
177 0.26
178 0.24
179 0.24
180 0.2
181 0.19
182 0.19
183 0.19
184 0.18
185 0.12
186 0.1
187 0.08
188 0.08
189 0.08
190 0.08
191 0.11
192 0.16
193 0.2
194 0.27
195 0.33
196 0.41
197 0.43
198 0.52
199 0.58
200 0.61
201 0.67
202 0.71
203 0.76
204 0.8
205 0.87
206 0.85
207 0.81
208 0.74
209 0.7
210 0.64
211 0.56
212 0.47
213 0.44
214 0.36
215 0.31
216 0.29
217 0.25
218 0.21
219 0.22
220 0.29
221 0.28
222 0.33
223 0.39
224 0.48
225 0.53
226 0.62
227 0.67
228 0.68
229 0.69
230 0.71
231 0.7
232 0.67
233 0.71
234 0.7
235 0.67
236 0.64
237 0.62
238 0.57
239 0.52
240 0.51
241 0.44
242 0.38
243 0.34
244 0.32
245 0.27
246 0.28
247 0.28
248 0.2
249 0.19
250 0.16
251 0.12
252 0.09
253 0.09
254 0.06
255 0.07
256 0.06
257 0.04
258 0.03
259 0.03
260 0.03
261 0.04
262 0.05
263 0.05
264 0.12
265 0.13
266 0.16
267 0.23
268 0.32
269 0.42
270 0.51
271 0.6
272 0.62
273 0.71
274 0.74
275 0.76
276 0.78
277 0.79
278 0.79
279 0.79
280 0.76
281 0.76
282 0.74
283 0.74
284 0.72
285 0.65
286 0.57
287 0.51
288 0.47
289 0.41
290 0.41
291 0.39
292 0.33
293 0.36
294 0.37
295 0.39
296 0.43
297 0.47
298 0.49
299 0.5
300 0.55
301 0.54
302 0.53
303 0.58
304 0.56
305 0.54
306 0.54
307 0.49
308 0.42
309 0.37
310 0.36
311 0.28
312 0.3
313 0.3