Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XAL0

Protein Details
Accession A0A0S6XAL0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
16-45LWKIPWRLSAPRKLRHRRRLRRVDNSEDSLHydrophilic
89-113RKERGYRKGIHKLPKWTRVSQRLNPBasic
NLS Segment(s)
PositionSequence
25-37APRKLRHRRRLRR
Subcellular Location(s) mito 20, mito_nucl 13.166, cyto_mito 11.166, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTSSLSVGLLWKIPWRLSAPRKLRHRRRLRRVDNSEDSLIGEVRTTSQAAHANGTIKLLERWKADMPSEQDMVSRDKYTIFDRKERGYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.17
5 0.18
6 0.18
7 0.18
8 0.21
9 0.3
10 0.36
11 0.46
12 0.5
13 0.57
14 0.68
15 0.76
16 0.82
17 0.84
18 0.88
19 0.89
20 0.91
21 0.94
22 0.93
23 0.93
24 0.9
25 0.88
26 0.83
27 0.76
28 0.66
29 0.54
30 0.44
31 0.34
32 0.26
33 0.17
34 0.11
35 0.06
36 0.06
37 0.07
38 0.06
39 0.06
40 0.08
41 0.12
42 0.13
43 0.14
44 0.14
45 0.14
46 0.14
47 0.15
48 0.12
49 0.09
50 0.1
51 0.11
52 0.13
53 0.13
54 0.16
55 0.18
56 0.19
57 0.2
58 0.23
59 0.25
60 0.25
61 0.25
62 0.22
63 0.21
64 0.21
65 0.24
66 0.21
67 0.18
68 0.14
69 0.15
70 0.17
71 0.21
72 0.28
73 0.29
74 0.34
75 0.37
76 0.44
77 0.52
78 0.56
79 0.57
80 0.56
81 0.6
82 0.63
83 0.69
84 0.7
85 0.71
86 0.72
87 0.78
88 0.79
89 0.81
90 0.77
91 0.75
92 0.77
93 0.78
94 0.8
95 0.77
96 0.79