Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LNV4

Protein Details
Accession A0A0C9LNV4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-45PCCPPRCPPRCPPRCPPRCSHydrophilic
55-100GCPPRCPPRCPPRCPPRCPPRCPPRCPPRCPFRCPPRCPPRCPPGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MDQVIAQRCRCGQPCCPPCCPPRCPPCCPPRCPPRCPPRCPPRCSLGCPPRSSLGCPPRCPPRCPPRCPPRCPPRCPPRCPPRCPFRCPPRCPPRCPPGCPTSRFPQLPLSGFLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.64
4 0.63
5 0.66
6 0.68
7 0.66
8 0.64
9 0.66
10 0.66
11 0.68
12 0.71
13 0.73
14 0.74
15 0.74
16 0.74
17 0.74
18 0.75
19 0.75
20 0.76
21 0.76
22 0.77
23 0.78
24 0.79
25 0.79
26 0.81
27 0.79
28 0.74
29 0.71
30 0.67
31 0.66
32 0.66
33 0.64
34 0.6
35 0.57
36 0.55
37 0.5
38 0.46
39 0.43
40 0.41
41 0.41
42 0.4
43 0.41
44 0.42
45 0.48
46 0.51
47 0.51
48 0.52
49 0.53
50 0.58
51 0.63
52 0.7
53 0.71
54 0.77
55 0.8
56 0.82
57 0.82
58 0.82
59 0.82
60 0.82
61 0.82
62 0.82
63 0.82
64 0.82
65 0.82
66 0.82
67 0.82
68 0.8
69 0.8
70 0.78
71 0.79
72 0.79
73 0.79
74 0.8
75 0.8
76 0.83
77 0.83
78 0.83
79 0.83
80 0.82
81 0.81
82 0.79
83 0.77
84 0.73
85 0.72
86 0.72
87 0.69
88 0.66
89 0.64
90 0.65
91 0.61
92 0.57
93 0.55
94 0.53
95 0.5