Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WZ12

Protein Details
Accession Q4WZ12    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28FGRPWPRRGPPWQRLSLPRRSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011706  Cu-oxidase_C  
IPR045087  Cu-oxidase_fam  
IPR011707  Cu-oxidase_N  
IPR008972  Cupredoxin  
IPR001287  NO2-reductase_Cu  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0050421  F:nitrite reductase (NO-forming) activity  
GO:0016491  F:oxidoreductase activity  
GO:0006807  P:nitrogen compound metabolic process  
KEGG afm:AFUA_3G14950  -  
Pfam View protein in Pfam  
PF07731  Cu-oxidase_2  
PF07732  Cu-oxidase_3  
CDD cd11020  CuRO_1_CuNIR  
cd04208  CuRO_2_CuNIR  
Amino Acid Sequences MSKYVLFGRPWPRRGPPWQRLSLPRRSPALIKPLSTGTTPKPTSSRPNGRLQVWPWLAGPILGVSLFLSAHRRPMQLETDTGLQRGNLTRDESQDDIDLPKEDAILTTAPNVPPPITRTRPVLLHVPLTTATKTRQLTSQYKYDTWTFNDTVPGPFIRARVGDVVELTLTNHDLSGNPHNIDCHAFTGPGGGAAVTTAEEHETKTARFKLLYPGLFVYHCAAAPVPVHIANGMYGLIYVQPEDGDALSPVDREYYVMQSEFYHEPPEIEDNGRPSSTVEFSYPAALREEPSAVVFNGSESALTRDRPLKAKTGESVRIFFGNAGPNLTSSFHVIGSHFQHVFRDGGVVDPPARVLSTVGVPPGGAAIVDLKMIVPGTYTLVDHAIFRMDKGAVGYLNVAGAPRPDILYSQMPPEPCVGCKLHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.74
4 0.75
5 0.78
6 0.78
7 0.82
8 0.8
9 0.8
10 0.77
11 0.73
12 0.68
13 0.63
14 0.61
15 0.58
16 0.61
17 0.54
18 0.48
19 0.44
20 0.43
21 0.42
22 0.38
23 0.36
24 0.31
25 0.37
26 0.37
27 0.37
28 0.38
29 0.42
30 0.5
31 0.56
32 0.62
33 0.57
34 0.66
35 0.69
36 0.68
37 0.7
38 0.62
39 0.62
40 0.52
41 0.48
42 0.38
43 0.33
44 0.3
45 0.22
46 0.2
47 0.1
48 0.09
49 0.07
50 0.07
51 0.05
52 0.06
53 0.06
54 0.07
55 0.12
56 0.11
57 0.19
58 0.23
59 0.24
60 0.25
61 0.3
62 0.35
63 0.32
64 0.34
65 0.29
66 0.31
67 0.31
68 0.29
69 0.25
70 0.19
71 0.19
72 0.21
73 0.21
74 0.18
75 0.21
76 0.23
77 0.26
78 0.3
79 0.28
80 0.26
81 0.24
82 0.22
83 0.19
84 0.18
85 0.17
86 0.13
87 0.12
88 0.11
89 0.1
90 0.09
91 0.1
92 0.09
93 0.08
94 0.1
95 0.13
96 0.13
97 0.14
98 0.15
99 0.14
100 0.15
101 0.19
102 0.25
103 0.26
104 0.29
105 0.32
106 0.34
107 0.35
108 0.36
109 0.38
110 0.32
111 0.31
112 0.29
113 0.26
114 0.24
115 0.24
116 0.22
117 0.18
118 0.17
119 0.21
120 0.22
121 0.21
122 0.25
123 0.3
124 0.36
125 0.38
126 0.44
127 0.41
128 0.4
129 0.42
130 0.41
131 0.36
132 0.32
133 0.34
134 0.28
135 0.25
136 0.27
137 0.25
138 0.23
139 0.22
140 0.18
141 0.15
142 0.15
143 0.15
144 0.13
145 0.13
146 0.13
147 0.13
148 0.14
149 0.12
150 0.11
151 0.11
152 0.09
153 0.09
154 0.08
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.09
162 0.14
163 0.16
164 0.16
165 0.16
166 0.17
167 0.17
168 0.18
169 0.16
170 0.13
171 0.1
172 0.1
173 0.1
174 0.11
175 0.09
176 0.08
177 0.07
178 0.05
179 0.04
180 0.04
181 0.04
182 0.03
183 0.03
184 0.03
185 0.04
186 0.05
187 0.05
188 0.07
189 0.08
190 0.08
191 0.13
192 0.14
193 0.14
194 0.15
195 0.16
196 0.22
197 0.27
198 0.27
199 0.24
200 0.23
201 0.23
202 0.22
203 0.22
204 0.15
205 0.1
206 0.09
207 0.08
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.06
214 0.06
215 0.06
216 0.07
217 0.06
218 0.06
219 0.05
220 0.04
221 0.03
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.03
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.06
236 0.05
237 0.06
238 0.06
239 0.06
240 0.07
241 0.09
242 0.1
243 0.1
244 0.11
245 0.1
246 0.14
247 0.15
248 0.14
249 0.14
250 0.13
251 0.13
252 0.13
253 0.16
254 0.14
255 0.14
256 0.15
257 0.16
258 0.18
259 0.18
260 0.16
261 0.15
262 0.15
263 0.15
264 0.15
265 0.13
266 0.13
267 0.13
268 0.17
269 0.17
270 0.15
271 0.16
272 0.15
273 0.15
274 0.14
275 0.15
276 0.11
277 0.12
278 0.12
279 0.1
280 0.11
281 0.1
282 0.08
283 0.09
284 0.08
285 0.07
286 0.06
287 0.11
288 0.12
289 0.12
290 0.15
291 0.19
292 0.23
293 0.29
294 0.3
295 0.34
296 0.36
297 0.39
298 0.41
299 0.44
300 0.48
301 0.45
302 0.44
303 0.38
304 0.35
305 0.32
306 0.27
307 0.23
308 0.21
309 0.18
310 0.18
311 0.17
312 0.17
313 0.18
314 0.18
315 0.16
316 0.13
317 0.14
318 0.13
319 0.13
320 0.14
321 0.17
322 0.2
323 0.24
324 0.22
325 0.22
326 0.22
327 0.23
328 0.23
329 0.19
330 0.17
331 0.11
332 0.12
333 0.13
334 0.14
335 0.13
336 0.12
337 0.12
338 0.11
339 0.11
340 0.1
341 0.09
342 0.09
343 0.11
344 0.13
345 0.13
346 0.12
347 0.12
348 0.11
349 0.11
350 0.09
351 0.05
352 0.05
353 0.06
354 0.06
355 0.06
356 0.06
357 0.06
358 0.07
359 0.07
360 0.07
361 0.06
362 0.06
363 0.09
364 0.1
365 0.1
366 0.1
367 0.12
368 0.13
369 0.12
370 0.12
371 0.15
372 0.14
373 0.14
374 0.16
375 0.15
376 0.16
377 0.16
378 0.18
379 0.14
380 0.14
381 0.15
382 0.12
383 0.12
384 0.12
385 0.1
386 0.08
387 0.09
388 0.1
389 0.1
390 0.11
391 0.12
392 0.13
393 0.17
394 0.23
395 0.23
396 0.27
397 0.29
398 0.28
399 0.29
400 0.32
401 0.3
402 0.25
403 0.29