Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WTP8

Protein Details
Accession Q4WTP8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAAVKKRLKRPKLLSHTRPPTARHydrophilic
NLS Segment(s)
PositionSequence
5-28KKRLKRPKLLSHTRPPTARAQNPK
Subcellular Location(s) mito 11, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
KEGG afm:AFUA_5G05660  -  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAAVKKRLKRPKLLSHTRPPTARAQNPKLSAKATRNLIRTHHRLLKSRAQALKAGNEDLVREIDERIEANGGLESYQLASKLGQSLERGGDSSKVLVDWIAPSLTQLKNSPYKLRMLEVGALSTENACSKNQYLDVTRIDLNAQEPGILKQDFMKRPLPLTDGDRFHIISLSLVLNYVPNATGRGDMLKRCVGFLTQTPPAGSSITIRPSLFLVLPLACVKNSRYLTPSRLQDILSSMGFTLAKSKETSKLIFQLWEHDRQGEPRPFKKEILNPGKMRNNFAINVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.89
4 0.86
5 0.79
6 0.71
7 0.7
8 0.7
9 0.68
10 0.68
11 0.67
12 0.68
13 0.71
14 0.73
15 0.66
16 0.6
17 0.59
18 0.55
19 0.54
20 0.54
21 0.54
22 0.53
23 0.54
24 0.57
25 0.58
26 0.58
27 0.59
28 0.59
29 0.58
30 0.62
31 0.65
32 0.68
33 0.67
34 0.69
35 0.65
36 0.59
37 0.57
38 0.53
39 0.53
40 0.45
41 0.38
42 0.31
43 0.27
44 0.25
45 0.22
46 0.2
47 0.14
48 0.12
49 0.12
50 0.1
51 0.11
52 0.11
53 0.1
54 0.1
55 0.09
56 0.09
57 0.09
58 0.08
59 0.07
60 0.07
61 0.06
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.1
69 0.11
70 0.11
71 0.12
72 0.14
73 0.15
74 0.15
75 0.15
76 0.13
77 0.14
78 0.12
79 0.12
80 0.1
81 0.08
82 0.08
83 0.07
84 0.07
85 0.06
86 0.07
87 0.06
88 0.06
89 0.06
90 0.11
91 0.12
92 0.13
93 0.14
94 0.17
95 0.24
96 0.26
97 0.3
98 0.27
99 0.31
100 0.31
101 0.3
102 0.28
103 0.23
104 0.24
105 0.19
106 0.17
107 0.13
108 0.12
109 0.11
110 0.09
111 0.08
112 0.06
113 0.07
114 0.06
115 0.08
116 0.09
117 0.1
118 0.11
119 0.13
120 0.14
121 0.16
122 0.17
123 0.18
124 0.18
125 0.16
126 0.15
127 0.14
128 0.12
129 0.1
130 0.08
131 0.07
132 0.07
133 0.08
134 0.11
135 0.1
136 0.1
137 0.13
138 0.21
139 0.22
140 0.25
141 0.28
142 0.25
143 0.27
144 0.28
145 0.25
146 0.2
147 0.23
148 0.25
149 0.23
150 0.24
151 0.24
152 0.22
153 0.21
154 0.19
155 0.15
156 0.09
157 0.09
158 0.08
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.05
166 0.05
167 0.06
168 0.06
169 0.07
170 0.07
171 0.11
172 0.13
173 0.14
174 0.17
175 0.19
176 0.19
177 0.19
178 0.19
179 0.15
180 0.15
181 0.17
182 0.19
183 0.18
184 0.19
185 0.19
186 0.19
187 0.19
188 0.18
189 0.16
190 0.13
191 0.14
192 0.16
193 0.19
194 0.18
195 0.17
196 0.18
197 0.19
198 0.16
199 0.13
200 0.12
201 0.1
202 0.12
203 0.13
204 0.13
205 0.11
206 0.13
207 0.13
208 0.2
209 0.22
210 0.22
211 0.24
212 0.28
213 0.34
214 0.4
215 0.43
216 0.38
217 0.38
218 0.36
219 0.34
220 0.32
221 0.29
222 0.22
223 0.18
224 0.14
225 0.15
226 0.14
227 0.13
228 0.16
229 0.14
230 0.16
231 0.18
232 0.2
233 0.25
234 0.29
235 0.32
236 0.3
237 0.35
238 0.35
239 0.37
240 0.35
241 0.38
242 0.38
243 0.42
244 0.39
245 0.36
246 0.36
247 0.36
248 0.45
249 0.45
250 0.49
251 0.49
252 0.55
253 0.56
254 0.57
255 0.62
256 0.6
257 0.62
258 0.64
259 0.67
260 0.64
261 0.7
262 0.76
263 0.7
264 0.67
265 0.62
266 0.56