Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S6XQ39

Protein Details
Accession A0A0S6XQ39    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
110-139LQPLPCRSSHERERKCCKCKGRLSCRVVSQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, cyto 4.5, cyto_nucl 4.5, mito 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR000757  GH16  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
PROSITE View protein in PROSITE  
PS51762  GH16_2  
CDD cd02181  GH16_fungal_Lam16A_glucanase  
Amino Acid Sequences MTAPNHTRAPHGVGPKSCNMASLDLAEHLDSDFAEPASPAVASTWTLTSGQAYDPHPPPAMAASLSMVALQVHQFSRVGRHASLLCVTSLTYVTPAIHSSLRPHSHRSALQPLPCRSSHERERKCCKCKGRLSCRVVSQANFNRREPINISLLAQSFTLVDTYSGSNFFNKFNFFTSGDPTDGWVYYVDYNTAVATHLIPDPNVPNWGVDIVNTLDPGSGVGRPSIRMTSQATYNHGLFIADVQHMPDSTCGLWPAYWFLGQNGVWPNSGELDVIEGVNNGQTNLLSGHTKDGCTISGSGQTGILETNNCAVPYSTTGCSTSDSRTNSYGSGFNAEGGGVYAVDWTSQSINVWFFPRDAIPYSILSNNPNPAADFGTPTAVFAGSCDIDSMFYDMAIVFDTTFCGQWAGNVYQSMGCPMYSGQASWPSCVTFVAENPGAFDQAYWYINYIKVYNQNGPNRLVPQAIESEVPRMSPNITGANIAMGRPSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.55
4 0.47
5 0.43
6 0.37
7 0.33
8 0.29
9 0.26
10 0.23
11 0.19
12 0.2
13 0.17
14 0.16
15 0.13
16 0.12
17 0.09
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.07
27 0.07
28 0.08
29 0.08
30 0.1
31 0.11
32 0.11
33 0.12
34 0.12
35 0.13
36 0.13
37 0.14
38 0.17
39 0.18
40 0.24
41 0.26
42 0.3
43 0.29
44 0.28
45 0.26
46 0.24
47 0.23
48 0.16
49 0.15
50 0.12
51 0.12
52 0.12
53 0.11
54 0.09
55 0.07
56 0.08
57 0.08
58 0.1
59 0.1
60 0.11
61 0.12
62 0.13
63 0.19
64 0.23
65 0.26
66 0.23
67 0.27
68 0.27
69 0.28
70 0.3
71 0.25
72 0.2
73 0.17
74 0.16
75 0.13
76 0.12
77 0.1
78 0.09
79 0.09
80 0.09
81 0.1
82 0.1
83 0.12
84 0.13
85 0.13
86 0.17
87 0.25
88 0.32
89 0.33
90 0.39
91 0.4
92 0.45
93 0.48
94 0.49
95 0.5
96 0.49
97 0.52
98 0.55
99 0.54
100 0.52
101 0.49
102 0.5
103 0.47
104 0.5
105 0.54
106 0.57
107 0.63
108 0.68
109 0.79
110 0.81
111 0.82
112 0.82
113 0.81
114 0.8
115 0.81
116 0.82
117 0.82
118 0.83
119 0.83
120 0.8
121 0.76
122 0.73
123 0.65
124 0.55
125 0.54
126 0.52
127 0.54
128 0.52
129 0.48
130 0.47
131 0.45
132 0.47
133 0.4
134 0.35
135 0.3
136 0.27
137 0.27
138 0.24
139 0.24
140 0.21
141 0.18
142 0.14
143 0.1
144 0.1
145 0.09
146 0.06
147 0.05
148 0.06
149 0.07
150 0.08
151 0.09
152 0.09
153 0.11
154 0.12
155 0.13
156 0.14
157 0.15
158 0.15
159 0.17
160 0.21
161 0.2
162 0.2
163 0.23
164 0.23
165 0.22
166 0.21
167 0.19
168 0.17
169 0.15
170 0.15
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.08
177 0.08
178 0.07
179 0.07
180 0.06
181 0.05
182 0.05
183 0.06
184 0.08
185 0.08
186 0.08
187 0.09
188 0.1
189 0.11
190 0.12
191 0.11
192 0.09
193 0.09
194 0.1
195 0.09
196 0.07
197 0.08
198 0.08
199 0.08
200 0.08
201 0.08
202 0.07
203 0.06
204 0.07
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.08
211 0.09
212 0.1
213 0.1
214 0.12
215 0.14
216 0.14
217 0.18
218 0.19
219 0.21
220 0.22
221 0.22
222 0.2
223 0.17
224 0.15
225 0.11
226 0.1
227 0.08
228 0.06
229 0.06
230 0.06
231 0.06
232 0.07
233 0.07
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.11
248 0.11
249 0.14
250 0.15
251 0.16
252 0.15
253 0.15
254 0.15
255 0.12
256 0.13
257 0.09
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.05
264 0.05
265 0.06
266 0.06
267 0.04
268 0.04
269 0.04
270 0.05
271 0.05
272 0.07
273 0.07
274 0.07
275 0.11
276 0.12
277 0.12
278 0.12
279 0.13
280 0.12
281 0.13
282 0.13
283 0.1
284 0.13
285 0.13
286 0.13
287 0.12
288 0.12
289 0.1
290 0.1
291 0.1
292 0.06
293 0.06
294 0.08
295 0.08
296 0.08
297 0.08
298 0.08
299 0.08
300 0.11
301 0.14
302 0.13
303 0.14
304 0.15
305 0.15
306 0.17
307 0.18
308 0.18
309 0.21
310 0.22
311 0.24
312 0.25
313 0.25
314 0.23
315 0.23
316 0.23
317 0.18
318 0.18
319 0.16
320 0.14
321 0.13
322 0.12
323 0.1
324 0.08
325 0.08
326 0.04
327 0.04
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.05
334 0.06
335 0.06
336 0.08
337 0.09
338 0.11
339 0.13
340 0.13
341 0.13
342 0.14
343 0.14
344 0.15
345 0.17
346 0.17
347 0.17
348 0.17
349 0.19
350 0.21
351 0.21
352 0.22
353 0.22
354 0.22
355 0.21
356 0.2
357 0.18
358 0.17
359 0.19
360 0.17
361 0.16
362 0.14
363 0.17
364 0.17
365 0.17
366 0.16
367 0.12
368 0.12
369 0.09
370 0.12
371 0.08
372 0.09
373 0.09
374 0.08
375 0.09
376 0.1
377 0.11
378 0.08
379 0.07
380 0.08
381 0.07
382 0.07
383 0.08
384 0.07
385 0.05
386 0.05
387 0.07
388 0.08
389 0.08
390 0.08
391 0.08
392 0.08
393 0.1
394 0.15
395 0.16
396 0.17
397 0.17
398 0.18
399 0.18
400 0.19
401 0.19
402 0.15
403 0.12
404 0.11
405 0.11
406 0.14
407 0.12
408 0.13
409 0.13
410 0.21
411 0.22
412 0.23
413 0.24
414 0.21
415 0.21
416 0.21
417 0.2
418 0.13
419 0.14
420 0.19
421 0.21
422 0.2
423 0.22
424 0.22
425 0.21
426 0.19
427 0.17
428 0.13
429 0.14
430 0.16
431 0.13
432 0.14
433 0.16
434 0.18
435 0.2
436 0.19
437 0.19
438 0.26
439 0.31
440 0.37
441 0.44
442 0.5
443 0.52
444 0.55
445 0.55
446 0.5
447 0.47
448 0.4
449 0.32
450 0.28
451 0.27
452 0.25
453 0.23
454 0.21
455 0.22
456 0.21
457 0.21
458 0.19
459 0.17
460 0.17
461 0.17
462 0.19
463 0.2
464 0.2
465 0.21
466 0.2
467 0.24
468 0.23
469 0.2
470 0.19